SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009489 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009489
Domain Number 1 Region: 32-128
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-24
Family SH2 domain 0.000013
Further Details:      
 
Domain Number 2 Region: 153-200
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000000641
Family SOCS box-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009489   Gene: ENSONIG00000007523   Transcript: ENSONIT00000009495
Sequence length 201
Comment pep:known_by_projection scaffold:Orenil1.0:GL831201.1:1081729:1083204:1 gene:ENSONIG00000007523 transcript:ENSONIT00000009495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCQSSESTETIEGDRRADNNTGAVESDESRVAAAMKELRNTGWYWGSLTANEAKEILQD
TAEGTFLLRDSSQRDYLFTISAMTSAGPTNLRIVFNHGKFKLDSVVLVKPKLKQFDSVVH
LVEYYVQLSRSRDKAAASNSQVSPVPPNGTVQLLLTKPVYTSTPSLQHLCRIAINQRTRQ
VQDLPLPNRLKDYLTDYAYNV
Download sequence
Identical sequences I3JKU5
ENSONIP00000009489 NP_001298247.1.78416 XP_003448796.1.78416 XP_019201899.1.78416 XP_019201900.1.78416 XP_019201901.1.78416 XP_019201902.1.78416 ENSONIP00000009489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]