SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009535 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009535
Domain Number 1 Region: 36-65,182-351
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.11e-54
Family G proteins 0.000000301
Further Details:      
 
Domain Number 2 Region: 65-184
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.7e-38
Family Transducin (alpha subunit), insertion domain 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009535   Gene: ENSONIG00000007563   Transcript: ENSONIT00000009541
Sequence length 357
Comment pep:known_by_projection scaffold:Orenil1.0:GL831236.1:954192:961543:-1 gene:ENSONIG00000007563 transcript:ENSONIT00000009541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITMGECCLSPEEEEKLRIHKEIERQLRRDKLASKRELKLLLLGTGESGKSTFIKQMRII
HGKGYNDTDRKGFTRVVYQNIIAGIQTMIKAMETLHIDYVDDQNIGYAEKLSQVDLTYLS
SLESWQVDAIKRVWNDHGVQRCYERRREFQISDSAKYYLTDLDRITAPSYIPTLQDILRV
RVPTTGIIEYPFEFSKNIFRMVDVGGQRCERKKWIHCFENVTSIIFLAALNEYDQVLYES
ENDNRLCESLALFRTITSWQWFQESSIILFLNKTDLLEEKIQHSHLATYFPEYTGPRQDA
ETAKKFILNMYVERHVGRHKALYTHYTCATDTENIRIVFKSVKDTLLQENLEQFNLE
Download sequence
Identical sequences I3JKZ1
XP_003451518.1.78416 ENSONIP00000009535 ENSONIP00000009535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]