SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009706 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009706
Domain Number 1 Region: 528-808
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.63e-52
Family Extended AAA-ATPase domain 0.0056
Further Details:      
 
Domain Number 2 Region: 813-997
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.71e-49
Family ATP-dependent protease Lon (La), catalytic domain 0.00001
Further Details:      
 
Domain Number 3 Region: 157-258
Classification Level Classification E-value
Superfamily PUA domain-like 0.0000000000221
Family LON domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009706   Gene: ENSONIG00000007700   Transcript: ENSONIT00000009712
Sequence length 1000
Comment pep:known_by_projection scaffold:Orenil1.0:GL831201.1:2112662:2136338:1 gene:ENSONIG00000007700 transcript:ENSONIT00000009712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCVKMIGAAKQLHRNSAFVAKLHWPGVVSRLTETSPLSRQQPARFYTSIGTPQKTCTS
PTTALTAGSRLTGRPHRWMRVGAVPHFQDSVLTRSCGPYTLQCRMYGNRAGAGFSGQDGE
DGASSGGEEPGGDGGAPYNGVQMTALTPMMVPEVFPNVPLIAVSRNPVFPRFIKIIEVKN
KALMELLRRKVRLAQPYAGVFMKRDDANESDVVESIDAIYTTGTFVQIHEMQDLGDKLRM
IVMGHRRIRITKQLQVEPEEEIASAVSESESEPESHQKPTQRRKTKRSRKDHLSSLPEQL
EDKISEADLSPELQPLPSSNILMVEVDNVQHEQFTVTEEVKALTAEIVKTIRDIIALNPL
YRESVLQMMQAGQRVVDNPIYLSDMGAALTGAESHELQDVLEETNIPKRLYKALSLLKKE
YELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKEDKDAIEEKFRERLKDRT
VPQHIMDVINEELNKLGLLDNHSSEFNVTRNYLDWLTSMPWGTNSEENLLLDRAKEVLEE
DHYGMDDVKKRILEFIAVSQLRGTTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSV
GGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLVLIDEVDKMGRGYQGDPSSALLE
LLDPEQNANFLDHYLDVPVDLSKVLFICTANVIDTIPEPLRDRMEMINVSGYVAQEKLAI
AERYLVPQLRSLCGLTEEKASISSDALSLLIKQYCRESGVRNLQKQVEKVFRKVAFCIVN
DEQTRVMVTPENLQEFVGKPIFTVDRMYDVTPPGVVMGLAWTALGGSTLFIETSLRRPPG
GADSKGEGSLEVTGQLGDVMKESAKIASTFARAFLMTQEPENHFLINSHLHLHVPEGATP
KDGPSAGCTIVTALLSLAINKPVRQNVAMTGEVSLMGKILPVGGIKEKTIAARRAGVTCI
ILPVENKKDFSDLPDYITQGLEVHFVDHYSQIYPIVFPQN
Download sequence
Identical sequences I3JLG2
ENSONIP00000009706 ENSONIP00000009706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]