SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009809 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009809
Domain Number 1 Region: 522-810
Classification Level Classification E-value
Superfamily RNI-like 1.07e-50
Family 28-residue LRR 0.00015
Further Details:      
 
Domain Number 2 Region: 798-965
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.44e-39
Family SPRY domain 0.0016
Further Details:      
 
Domain Number 3 Region: 87-272
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000287
Family G proteins 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009809   Gene: ENSONIG00000007787   Transcript: ENSONIT00000009815
Sequence length 966
Comment pep:novel scaffold:Orenil1.0:GL831357.1:26277:46433:1 gene:ENSONIG00000007787 transcript:ENSONIT00000009815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSEDVLKDFRLQEVLYELKISLRRRCERVTEGSDETGSRTLLNRIYTELYITEGQSEEVH
TQHEVRQLETASKMDALHDTPIRCHDIFKALPDQQRPIRLVLMNGIAGVGKTFTVQTFTL
GWAEGLENQHVSVVILLSFRELNLIRDEQYSLLELLHIFHPTLQKVTAEKLAVCKLLFIF
DGLDESRLSLDFTNRKLVSDVTQKSSVSQLLTNLIQGNLLPSALVWITSRPAAANQIPPT
CVDRLTEVRGFTDAQKEEYFRKRFSDEELSSRIISHMKTSRSLHIMCRIPVFCWITATVL
EHMLTTEQRGELPKTLTDMYSHFLLVQTNRKKNKYHEGHETSPQELMEADREVLLKLGRL
AFENLEKGNIMFYQEDLEQCGLDVTEALVYSGICTVIFKRECVIFQKPVYCFVHLSIQEF
LAAVYMFHCYTNTTVKVVVDFLRMDYNEPSLNVFLKRIMKKSLQSKNGHLDLFVRFLHGL
SLESNQRLLGGLLGQTENSQEIIQKVINNMKKINSDEISPDRSINIFHCLMEMNDLSVHQ
EIQKFLKSESRSERLSEIHCSALALMLQMSEEVLDELDLQKYNTSEQGRRRLIPAVRNCR
KARLSGCFLSEKSCEALSSVLSSQSSGLRVLDVSNNNLQDSGVMLLSAALQSPHCTLETL
RLSGCFLTERSCEALSPVLRSQSSSLKELDLSNNNIKESGVKLLSAELQSPHCTLETLRL
SGCLIRGEGCTSLATALSSNPSQLKELDLSYNDPGDSGKELLSVGLKDPHWRLDSLRVEP
AGVRWLRPGLRKCKCVFNVIHENLQLSDNNRKVTHVKEVQSYPDHPDRFDVPQLLCRNGL
TGRCYWEVEWRGNVYISVSYRRIRRKGNDCVFGGNDHSWSLYCSDGAPRSVWHNNRQTFI
SSSSFSSSSSVSNRIAVYVDCPAGTLSFYRVSSDTLIHLHTFNTTFTETLYSGFWFRFPG
ASVCLC
Download sequence
Identical sequences I3JLR5
ENSONIP00000009809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]