SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009833 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009833
Domain Number 1 Region: 557-820
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.7e-33
Family Extended AAA-ATPase domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000009833
Domain Number - Region: 830-922
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00517
Family Helicase DNA-binding domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009833   Gene: ENSONIG00000007807   Transcript: ENSONIT00000009839
Sequence length 925
Comment pep:known_by_projection scaffold:Orenil1.0:GL831201.1:2624844:2640159:-1 gene:ENSONIG00000007807 transcript:ENSONIT00000009839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMKYFTRMKIRRVYEWSGKPRSFNRRLKTYDYDSFAISVEGLSKIIINTGQDIFIEGCDE
DNPYVAKVTRLYGDENGQQMKAVVQWFIRVSELPVNKLKLLGREPHPQEIFYYECRNCDN
EVNVESILRPVKVKHLDSNDPFPDSADKDTLYVKLSWDSKVFRVVNSTVVESPAEPAPAS
SPPSSAATPRGPSRRVLPTPDHAIMHKASLGEVGCSSVGTPANVEAESLHSATKLSASKC
LSAKRRNATARTPGVRKRLELSSPEKSVTGEEVLSQLLNEELESKVTLTRRPPPSPAHPL
RVTHSLTPLRKAHRPTGAQCGVPLKSSSVFLNKWPLSDSESPLSPGLGIFNPWEGDEMVT
GSTKNLVRTQRIRDATPRRVFVQRVELKKATQKKELETIKEPVLSVLAEVENEKSPMVTE
TPRSSKRKSAMLVSSRIKKQLNLLENHQDPNSSGEEEDEFVPSKNDLLSSSEEEGQDEDG
PNIDDQVSAKKFRYVATGSRNSRSKQKSYSSARTQRRTPAKKISPGTPQTPRHATPSIPI
RSLQTQQPANILEEARARLHVSSVPESLPCREQEFQDIYSFVESKIVDNTGGCMYISGVP
GTGKTATVHEVIRCLQHAADMDEIPSFHFIEINGMKMTDPHQAYVQILQKLTGQKATPDH
AAVLLEKRFSNLAPRKETIVLLVDELDLLWTRKQNVMYNLFEWPARRHARLVVLTIANTM
DLPERIMINRVASRLGLTRMSFQPYSFKQLQEIIMSRLNKLKAFEEDALQLVSRKVAALS
GDARRCLDICRRATEICEHSAADPSSTGLVGMSHVMEALNEMFSSAYITAIRCASTQEQL
FLRAVITEFRRLGLEEATFQQVFVQHQALCRIEGLKPIGVSEGLAVCQRLGACRLLLLEP
SHLGVLQRIRLNVSQDDIFYALKAD
Download sequence
Identical sequences I3JLT9
ENSONIP00000009833 ENSONIP00000009833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]