SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009912 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009912
Domain Number 1 Region: 46-72,197-381
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.62e-51
Family G proteins 0.000000134
Further Details:      
 
Domain Number 2 Region: 76-201
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.44e-36
Family Transducin (alpha subunit), insertion domain 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009912   Gene: ENSONIG00000007862   Transcript: ENSONIT00000009918
Sequence length 385
Comment pep:known_by_projection scaffold:Orenil1.0:GL831357.1:682419:698309:-1 gene:ENSONIG00000007862 transcript:ENSONIT00000009918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADFLPSRSVLSAFFPNCLLTSGEAEQLRKSKEIDKCIHRDKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQKAKEEFRATIFSNVIKGIRVLVDAREKLHIPWGNPSNQRHGN
TMMAFDTRSAMAHGHGMVEPKVFQHYLPSIKALWADQGIQNAYDRRREFQLGESVKYFLD
NLEKLGQSDYLPSQQDILLARKPTKGIHEYDFEIKNVPFKMVDVGGQRSERRRWFECFDS
VTSILFLVSSSEYDQVREMQDRQTNRLSESLNIFETIVNNRVFSNVSIILFLNKTDLLGE
KVKQVSIKDYFPEFSGDPLSLADVQCFLVECFRKKRREQQQKPLQQQKPLYHHFTTAINT
ENIRLVFRDVKDTILHDNLKQLMLQ
Download sequence
Identical sequences I3JM18
ENSONIP00000009912 ENSONIP00000009912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]