SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009970 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009970
Domain Number 1 Region: 786-956
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-52
Family SPRY domain 0.0013
Further Details:      
 
Domain Number 2 Region: 518-774
Classification Level Classification E-value
Superfamily RNI-like 2.94e-30
Family 28-residue LRR 0.00074
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000009970
Domain Number - Region: 99-273
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.069
Family G proteins 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009970   Gene: ENSONIG00000007912   Transcript: ENSONIT00000009976
Sequence length 961
Comment pep:novel scaffold:Orenil1.0:GL831241.1:1796036:1800975:-1 gene:ENSONIG00000007912 transcript:ENSONIT00000009976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEEELADRLQSRTHAEVGKHKLKSALKKKFQRAFEGIVKAGNPTLLNQIYTELYITEGG
TAEVSDQHEIRQIETANRKPHRPETPIRQEDIFTVSPGKDEPIRTVLTKGVAGIGKTVLT
QKFTLDWAEGKANQDIQFMFPFTFRELNVLKEEKFSLVGLVHHFFTETKEAGICSFEDFQ
VVFIFDGLDECRLPLDFHKAKILTDPRKSTSVDVLLINLIRGKLLPSAHIWITTRPAAAN
QIPPDCVDMVTEVRGFTDPQKEEYFRKRFSDKKQASRIISHIKASRSLHIMCHIPVFCWI
TATVLEDVLKTREGGQLPKTLTEMYIHFLVVQAKVANIKYDGRREKDPIWIKKSRKMIES
LGKLAFDQLQKGNLIFYQSDLTESGINIRDASVYSGVFRQVFKEERGLYQDKVFCFIHLS
VQEFLAALHVHLTFINSGVNLLEKQQAIVHNIRSAVDKALESPNGHLDLFLRFLLGLSLQ
TNQTLLQGLLTQTGSNPGTRHKTVKFIIEKIGGNLSTEKSINLFHCLNELNDRSLMKEIQ
QPLISGSLSTDKLSSAQWSALVFILLSSEKDLDVFDLKKYSASEEALQRLLPVVKATNKA
LLCDCNLTETSCEALSSVLSSQSSRLRELDLSNNNLKDSGVKLLAAGVKSPHCRLESLSK
TLDYVCCKIGVLCYMGLSSKFLFLTVEVFDWNSFRNHGLLMLLPGLNNCLLASLLLSSCL
ITEEGCASLASALSSNPSYLRELDLRNNSLQDIGVNLLLAGLEDPYWRLDILRVDSGGEQ
KVTLDLRKFACELTLDLNTTHKNLKLFDNNRSVKVLKQQQPYLDHPERFDMFCQVLCKNG
LAGRCYWEVEWEGKVDVAVTRRGIPRKGYSRASRFGGNDQSWSLTCSDNGYSVWHNDRET
SISSSSISNRVAVYVDCPVGTLSFYRVSSDTLIHLHTFPIKFTQLLYPGFRVWDGSVTLC
S
Download sequence
Identical sequences I3JM76
ENSONIP00000009970 ENSONIP00000009970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]