SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010080 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010080
Domain Number 1 Region: 46-72,196-373
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.63e-54
Family G proteins 0.000000122
Further Details:      
 
Domain Number 2 Region: 76-200
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 8.5e-40
Family Transducin (alpha subunit), insertion domain 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010080   Gene: ENSONIG00000008004   Transcript: ENSONIT00000010089
Sequence length 377
Comment pep:known_by_projection scaffold:Orenil1.0:GL831265.1:1932400:1942511:1 gene:ENSONIG00000008004 transcript:ENSONIT00000010089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADFLPTRSVLKVCLPVCLLNSGEVEQLRKSKEIDRCLSKEKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQHAREEFRATIYSNVIKGIRVLVDAREKLHIPWGDEDNQPHGD
NLMAFDTRSAKMTSGQLETSVFLEYLPAIKALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGELDYLPTQQDILLARKPTKGIHEYDFEIKNVPFKMVDVGGQRSERRRWFECFDSV
TSILFLVSSSEYDQVLMEDRQTNRLRESLDIFETIVNNRVFNNVSIILFLNKTDLLEEKV
KNVPLKDYFPEYNGPEHSLPDVQAFMVECFRAKRRDCTQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
Download sequence
Identical sequences I3JMI6
XP_003453441.3.78416 ENSONIP00000010080 ENSONIP00000010080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]