SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010092 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000010092
Domain Number - Region: 3-88
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0446
Family G proteins 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010092   Gene: ENSONIG00000008012   Transcript: ENSONIT00000010101
Sequence length 377
Comment pep:novel scaffold:Orenil1.0:GL831701.1:48815:50194:1 gene:ENSONIG00000008012 transcript:ENSONIT00000010101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISAVGLVMKASDNRLSDRLMYVFDSVMSLFGKNMEKNIVALITHSDGSRPENVLEALKVA
AIKCAKNEKTEPVHFLFNNSQYEDQTEENTSSKHSWELTQENMNQLTDFLGKSNPQKLMT
TVEVLNERIRLKACIQNLQDRINQGEQKREEALKMQQSIKEHEEKMKRNEKFTVEVDKPY
KVKDPIDGGMRLLFFYAAAVCCTACEENCHYPGCTMAWKPKHCEVMKRGLCTVCTNKCPA
SDHVKEEVNETMKTVAVLSQSKKEKEQKYEKHQKESEEKCTLLENLENEMKQLTAERSQF
LDESYQHVVRLEQIALKADSLSTIVHLDFLIEKMKEKGDTEKVQKLEEMRSRVDEKTEKA
AHWYMQIPSAIKNIGRS
Download sequence
Identical sequences I3JMJ8
ENSONIP00000010092 ENSONIP00000010092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]