SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010203 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010203
Domain Number 1 Region: 511-712
Classification Level Classification E-value
Superfamily RNI-like 6.28e-32
Family 28-residue LRR 0.0014
Further Details:      
 
Domain Number 2 Region: 77-260
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000164
Family Nitrogenase iron protein-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010203   Gene: ENSONIG00000008099   Transcript: ENSONIT00000010212
Sequence length 787
Comment pep:novel scaffold:Orenil1.0:GL831486.1:410972:419755:-1 gene:ENSONIG00000008099 transcript:ENSONIT00000010212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQEIVKEHKIHLKRQYEHVTEGFGESGSGTLLNTIYTELYIIDEQSEEVHTQHEVRQLET
TSQTDTDHDPTIKCHKLFEVLPHLKRPIRVVLMNGIAGIGKTFSVQKFIVDWSEGSENQD
INIVILLSFRELNLVKDEPYSLLQLLHVFYPTLQKVTTEKLTLCKLLFIFDGLDESRLSL
EFSNRKVVSDITQKSSVSELVTNLIEGNLLPSALIWITTRPAAANQIPPTCVDRVTEVRG
FTDAQKEEYFRMRFSEKELSRVISHIKKSKNLNVICRIPVYCWITATILEYILNTDQRSE
LPKTLTDMYSYFLLVQTKRNKHKYQKGHETSPQELTDADREVLLKLGKLAFENLKKGNII
FYQEDLEECGLDVTEASVNSWVCTEIFKRECVIFQKPVYSFVHLSIQEFLAAVYTFQCYT
NRKTEVLKEVLGEEYNETSLDVFLSKVMEKSLQCKNGTLDLFVRFLHGLTLESSQRLLVG
LLSQTENNPEVIQKIINNLKEMRRSQISPDRSINIFHCLTEMNDSSLFQEIQESLKSETK
LSEIHCSALAYMLQMSEEVLDELDLQKFNTSDEGRHRLIPAVSNCRKALLQRCQLLKTHC
EVVASALKSDPSHLVELDMTGNKLHSSGLKFLSDGLSSPDCRLETLRLWGCKLSETSCDY
LFKALQSNSHLRELDLTKNNLQESHVKQLSELVDSPHHTLEVLKLSHCSVTFVYPGLKGD
ATVCKFSPTENTNLLMEGPINTVVCVCVHMCPDGSERLKHQQLVCSDAVTGTGYREVEWT
AELHPAV
Download sequence
Identical sequences I3JMV9
ENSONIP00000010203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]