SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010229 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010229
Domain Number 1 Region: 113-395
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.81e-64
Family Tandem AAA-ATPase domain 0.000000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010229   Gene: ENSONIG00000008122   Transcript: ENSONIT00000010238
Sequence length 427
Comment pep:known_by_projection scaffold:Orenil1.0:GL831154.1:716528:722771:1 gene:ENSONIG00000008122 transcript:ENSONIT00000010238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENDVDNELLDYEEDEEPQGAPESATPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAII
DCGFEHPSEVQHECIPQAILGMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCH
TRELAFQISKEYERFSKYMPTIKAAVFFGGLPIKKDEDVLKKNCPHIVVGTPGRILALIR
NKTLSLKNVKHFVLDECDKMLEQLDMRRDVQDIFRITPHEKQVMMFSATLSKEIRPVCRK
FMQDPMEVFVDDETKLTLHGLQQYYCKLKDSEKNRKLFDLLDVLEFNQVVIFVKSVQRCV
ALSQLLVEQNFPAIAIHRGMVQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIVFN
YDMPEDSDTYLHRVARAGRFGTKGLAITFVSDETDAKTLNDVQDRFEVNVAELPDEIDIS
SYIEQSR
Download sequence
Identical sequences I3JMY5
XP_003443119.1.78416 XP_004562993.1.88231 XP_005738104.1.53837 XP_005926773.1.24487 XP_006805133.1.46954 ENSONIP00000010229 ENSONIP00000010229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]