SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010277 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010277
Domain Number 1 Region: 507-704
Classification Level Classification E-value
Superfamily RNI-like 9.58e-24
Family 28-residue LRR 0.00087
Further Details:      
 
Domain Number 2 Region: 803-871
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000103
Family SPRY domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000010277
Domain Number - Region: 78-251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0876
Family Nucleotide and nucleoside kinases 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010277   Gene: ENSONIG00000008162   Transcript: ENSONIT00000010286
Sequence length 872
Comment pep:novel scaffold:Orenil1.0:GL831581.1:213222:221752:-1 gene:ENSONIG00000008162 transcript:ENSONIT00000010286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSTLKERFQCVFEGIAKAGNPTLLNEIYTELYITEGGTAEVNDKHEVRQIETVSRKRDRP
ETLIREEDIFKTSPGQLESIRTVLTKGVAGIGKTVLTQKYILDWAEDKANQNIQFMFPFT
FRELNVLKEEKFSLVGLVHHFFTETKEAGICSFEDFQVVFIFDGLDECRLPLDFHKTTII
TDPRESTSVDVLLINLIRGKLLPSAHLWITTRPAAANQIPPDYCVGMVTEVRGFTDPQKE
EYFRKRFRDEEQASRILSHVKTSRSLHIMCHIPVFCWITATVLENVLKTREGRLPKNLTE
MYIHFLVVQAKVKKVKFDEGAQTDSHWSPESRIMIESLGKLAFDHLQKGNLIFYESDLTE
CGIDIRAATVFAGVFTQIFKEERGLYQDKVFCFIHLSVQEFLAALHVHLNFINSGVNLLE
EQQTTSQKSETTESSATHFYQSAVNKALKSPNGHLDLFLRFLLGFSLQTSQTLLQGLQTQ
TGNSSQTNQETVQYIKKKLSENQSGEKSINLFHCLNELNDRSLVEEIQRYMSLGSFSIRN
HSPDQWSALVLILVSSKKDADRKTFSSEDALVELLPEVNASNKSLVMGCNLSEKSCEALS
SVLSSQSSSLGELDLSNSDLTGVKLLCDGLKNPNCKLNTLSLSGCLITEEGCTSLASALS
SNPSHLRELDLSYNHPGDSGMKLLSARLKDPGWRLDTLRYGGNGDQHISVLLTVQIKTQQ
TLEPGGTVSLALSTTKMCTSSSSLQPSQKNNLEKSPVKGVEAGSRHFSVCMHRNVESEHE
KFSGGIKTNENNHSEWCTDRSRISRNHQQFDPRMNSSVSNRVAVYVDCPAGTLSFYRVSS
DTLIHLHTFNTKFTETLYPGFGFNPGCSVSLC
Download sequence
Identical sequences I3JN33
ENSONIP00000010277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]