SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010319 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010319
Domain Number 1 Region: 971-1281
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.32e-69
Family Tandem AAA-ATPase domain 0.0000483
Further Details:      
 
Domain Number 2 Region: 725-969
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.88e-60
Family Tandem AAA-ATPase domain 0.0000478
Further Details:      
 
Domain Number 3 Region: 1403-1528
Classification Level Classification E-value
Superfamily Bromodomain 1.24e-31
Family Bromodomain 0.0012
Further Details:      
 
Domain Number 4 Region: 593-664
Classification Level Classification E-value
Superfamily BRK domain-like 3.27e-20
Family BRK domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010319   Gene: ENSONIG00000008196   Transcript: ENSONIT00000010328
Sequence length 1605
Comment pep:known_by_projection scaffold:Orenil1.0:GL831154.1:1012738:1026382:1 gene:ENSONIG00000008196 transcript:ENSONIT00000010328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPDPPMGGTPRPGPSPGPGPSPGGMMGPSPGPSPGSAHSMMGPSPGPPGSGHPHPPQG
PSGYPQDNMHQMHKPMEAMHEKGMPDDPRYGQMKGLGMRPGGHSGMGPPPSPMDQHSQGY
PSPLGGSEHAPSPVPANGPPSGPMMPGGPPGPGAGPMEGSGDSNQGGPTPFNQNQLHQLR
AQIMAYKMLARSQPLPEHLQMAVQGKRPMPGMQQQPMPNMPPSTGPGGGPGAGPGPAPAN
YNRQHGMVGPNIAPPGPAGVPPGMQGQPTNGPPKSWPEGPMVNAAAPSNPPQKLIPPQPT
GRPSPAPPSVPPAASPVMPPQTQSPGQPAQPPPMMLHQKQNRITPIQKPRGLDPVEILQE
REYRLQARISHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTA
LETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEY
HRSITAKIQKATKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKR
LAYLLQQTDEYVANLTELVRAHKAAQALKEKKKKKKKKKKPEAPEGAAPALGPDGEPLDE
TSQMSDLPVKVIHVDSGKILTGVEAPKAGQLEAWLEMNPGYEVAPRSDSEGSGSEEEEEE
EEEDDAQPQTSSAATEEKKKIPDPDSEDVSEVDVLHIIEHAKQDVDDEYGNASFNRGLQS
YYAVAHAVTEKVDKQSSLLVNGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI
ALITYLMEYKRINGPFLIIVPLSTLSNWVYEFDKWAPSVVKVSYKGSPAARRSFVPILRS
GKFNVLLTTYEYIIKDKQVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRLLLT
GTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHK
VLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKG
GTKTLMNTIMQLRKICNHPFMFQHIEESFSEHLGYSGGIITGPDLYRASGKFELLDRILP
KLRATNHKVLLFCQMTSLMTIMEDYFAYRNFKYLRLDGTTKAEDRGMLLKTFNDPASEYF
VFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSV
EEKILAAAKYKLNVDQKVIQAGMFDQKSSGYERRAFLQAILEHEEQDEEEDEVPDDETVN
QMIARSEEEFEQFMRMDLDRRREEARNPKRKPRLMEEDDLPGWILKDDAEVERLTCEEEE
EKMFGRGSRQRKEVDYSDSLTEKQWLKAIEEGNLEDIEEEVRHKKTTRKRKRDRDHDGGP
ATPSSSSGRGRDKDEDGKKAKKRGRPPAEKLSPNPPSLTKKMKKIVDAVIKYKDGNGRQL
SEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRSHKYRSLNDLEKDVMLLCQNAQTFNL
EGSLIYEDSIVLQSVFTSVRQKIEKEDESEGEESEEEEEEVDEGSESECRSVKVKIKLGR
KEKGERGGKGQRRRGRGARAKPVVSDDDSEEEQEEERSASGSEED
Download sequence
Identical sequences I3JN75
ENSONIP00000010319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]