SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010351 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010351
Domain Number 1 Region: 8-176
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000507
Family G proteins 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010351   Gene: ENSONIG00000008223   Transcript: ENSONIT00000010360
Sequence length 288
Comment pep:known_by_projection scaffold:Orenil1.0:GL831154.1:1139560:1146922:-1 gene:ENSONIG00000008223 transcript:ENSONIT00000010360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASATQSAELRLVVLGRSGAGKKTAICKILGLQDYQQDTDDDAVQECSKHRGEVAGRQVVI
VSSPAWHGSGCNSEERRKYISSFIASSSPGPHAFLLCVPANQPADEEAKALDVLKKLFGS
SAVSRNTIILFTHTDVLDEDEQLEEYLVTWRKDLMELVEKCGERYHTLEARSGEQDGKTA
VEELLEKVEQAVMKSGGLHFSCPLYQEAEERVRERQAEIVRQRRREELNDQVSPTDSQPE
NEEELEEVREEAERSIGNTKKNPQVNVYERTPVQILFSLSGYTPRIRQ
Download sequence
Identical sequences I3JNA7
ENSONIP00000010351 ENSONIP00000010351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]