SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010441 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010441
Domain Number 1 Region: 57-629,662-873
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.34e-290
Family Motor proteins 3.94e-16
Further Details:      
 
Domain Number 2 Region: 874-999
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.49e-25
Family Myosin rod fragments 0.00021
Further Details:      
 
Domain Number 3 Region: 994-1109
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.15e-20
Family Myosin rod fragments 0.0015
Further Details:      
 
Domain Number 4 Region: 1271-1387
Classification Level Classification E-value
Superfamily Myosin rod fragments 3.92e-17
Family Myosin rod fragments 0.0022
Further Details:      
 
Domain Number 5 Region: 1387-1490
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000628
Family Myosin rod fragments 0.005
Further Details:      
 
Domain Number 6 Region: 1723-1839
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000061
Family Myosin rod fragments 0.0088
Further Details:      
 
Domain Number 7 Region: 1102-1188
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000149
Family Myosin rod fragments 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000010441
Domain Number - Region: 31-64
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.000785
Family Myosin S1 fragment, N-terminal domain 0.001
Further Details:      
 
Domain Number - Region: 1579-1698
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000902
Family Myosin rod fragments 0.0043
Further Details:      
 
Domain Number - Region: 1846-1960
Classification Level Classification E-value
Superfamily Tropomyosin 0.00124
Family Tropomyosin 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010441   Gene: ENSONIG00000008299   Transcript: ENSONIT00000010450
Sequence length 2012
Comment pep:known_by_projection scaffold:Orenil1.0:GL831154.1:1598020:1655373:-1 gene:ENSONIG00000008299 transcript:ENSONIT00000010450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHRSGQEDPERYLFVDRAVVYNPATQADWTAKKLVWVPSERHGFEAAGIREERGEEVLV
ELAENGKKVVINKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPPDSPKAFKLQGELERQLLQANPILESFGN
AKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIFYRLLAG
AGEHLRTDLLLEGFNNYRFLSNGNIPIPGQQDKENFQETMEAMHIMSFSHDEIVCMLKVV
SAVLQFGNIVFKKERNTDQASMPENTAAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQK
AQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNS
FEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWSFIDFGLDLQPCIDLIERPNNPPG
ILALLDEECWFPKATDKTFVDKVLQELGTHSKFQKPRQLKDKADFCIIHYAGRVDYKADE
WLMKNMDPLNDNVATLLHQSTDKFVAELWKDDIQTFQRASFYDNVSGLHEAPVDRIVGLD
QVAGMNETAFGAAYKTKKGMFRTVGQLYKEQLSKLMATLRNTNPNFVRCIIPNHEKRAGK
LDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACER
MIQALELDGNLFRIGQSKIFFRAGVLAHLEEERDLKITDIIIYFQAVCRGYLARKAFAKK
QQQLSALKVLQRNCAAYLKLRHWQWWRLFTKVKPLLQVTRQEEELQAKDEELVKVKEKQM
KVEGELVEMERKHQQLMEEKNILAEQLQAETELFAEAEEMRARLASKKQELEEILHDLES
RLEEEEERSQELQNEKKKMQSHIQDLEEQLDEEEAARQKLQLEKVTAEAKMKKYEEDILL
LEDQNSKFLKEKKLLEDRINEVTSMLAEEEEKAKNLGKVKNKQEMMMVDLEERLKKEEKT
RQELEKAKRKLDGETSDFQDQISELQSQIEELKMQLSKKDDEQQMMQARSEEEVSHKNNA
LKQIRELQAQLSELQEDLESEKQARNKAEKLKRDLSEELEALKTELEDTLDTTAAQQELR
TKREQEVAELKKAIEEETKNHEAQIQEMRQRHGTALEELSEQLEQAKRFKANLEKTKQSQ
ETANKELASEVKSLQQAKQESEHKRKKLEAQLQEFMARVTEGERSKGELAERSHKLQTEL
DNVSTMLEDAERKGIKLAKDVAGLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNTLQ
EQQEEDEEARKNLEKQMFTLQAQLSESKKKLEDDVGTIEGLEETKKKLQKDLELANQRLE
EKTIAFEKMEKTKTRLQQELDDLTVDLDHQRQIVSNLEKKQKKFDQMLAEEKSISARYAE
ERDRAEAEAREKETKALSMARALDEALEAKEELERINKQLRAEMEDLMSSKDDVGKNVHE
LEKSKRTLEQQLEEEMKTQLEELEDELQATEDAKLRLEVNMQAMKAQYERDLQGRDDQND
EKKRALVKQVREMEAELEDERKQRALAVAARKKLEMDLKDIEGHIEGANKARDEAIKQLR
KLQAQMKDYQRELEDTRASRDDIFALSKENEKKLKSLEAEIVQLHEDLAASERGRRHAEQ
ERDELQDEISNSTSGKAALMDEKRRLEARIAQLEEELEEEQGNMELLNDRFRKTTMQVDT
LTTELSAERSTAQKSENARQQLERQNKELRAKLGELEGSVKNRFKASITALEAKIAQLEE
QLEQEARERAAANKIVRRTEKKLKEVCMQVEDERRHADQFKEQVEKANSRMKQLKRQLEE
AEEEATRANASRRKLQRELDDATEASEGLSREVHTLKNRLRRGGPITFSSSRSGRRPLQV
EGTSSLDLLSDDELENKITDNNANETPAPQTE
Download sequence
Identical sequences I3JNJ7
ENSONIP00000010441 ENSONIP00000010441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]