SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010442 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010442
Domain Number 1 Region: 57-852
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.05e-291
Family Motor proteins 2.36e-16
Further Details:      
 
Domain Number 2 Region: 853-978
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.05e-25
Family Myosin rod fragments 0.00021
Further Details:      
 
Domain Number 3 Region: 973-1088
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.37e-21
Family Myosin rod fragments 0.0015
Further Details:      
 
Domain Number 4 Region: 1250-1366
Classification Level Classification E-value
Superfamily Myosin rod fragments 2.62e-17
Family Myosin rod fragments 0.0022
Further Details:      
 
Domain Number 5 Region: 1364-1469
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000889
Family Myosin rod fragments 0.0046
Further Details:      
 
Domain Number 6 Region: 1079-1168
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000471
Family Myosin rod fragments 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000010442
Domain Number - Region: 31-64
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.000589
Family Myosin S1 fragment, N-terminal domain 0.001
Further Details:      
 
Domain Number - Region: 1476-1577
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00157
Family Myosin rod fragments 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010442   Gene: ENSONIG00000008299   Transcript: ENSONIT00000010451
Sequence length 1587
Comment pep:known_by_projection scaffold:Orenil1.0:GL831154.1:1600571:1655406:-1 gene:ENSONIG00000008299 transcript:ENSONIT00000010451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHRSGQEDPERYLFVDRAVVYNPATQADWTAKKLVWVPSERHGFEAAGIREERGEEVLV
ELAENGKKVVINKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPPDSPKAFKLQGELERQLLQANPILESFGN
AKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIFYRLLAG
AGEHLRTDLLLEGFNNYRFLSNGNIPIPGQQDKENFQETMEAMHIMSFSHDEIVCMLKVV
SAVLQFGNIVFKKERNTDQASMPENTAAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQK
AQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNS
FEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWSFIDFGLDLQPCIDLIERPNNPPG
ILALLDEECWFPKATDKTFVDKVLQELGTHSKFQKPRQLKDKADFCIIHYAGRVDYKADE
WLMKNMDPLNDNVATLLHQSTDKFVAELWKDVDRIVGLDQVAGMNETAFGAAYKTKKGMF
RTVGQLYKEQLSKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRI
CRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIQALELDGNLFRIGQSKIFF
RAGVLAHLEEERDLKITDIIIYFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLR
HWQWWRLFTKVKPLLQVTRQEEELQAKDEELVKVKEKQMKVEGELVEMERKHQQLMEEKN
ILAEQLQAETELFAEAEEMRARLASKKQELEEILHDLESRLEEEEERSQELQNEKKKMQS
HIQDLEEQLDEEEAARQKLQLEKVTAEAKMKKYEEDILLLEDQNSKFLKEKKLLEDRINE
VTSMLAEEEEKAKNLGKVKNKQEMMMVDLEERLKKEEKTRQELEKAKRKLDGETSDFQDQ
ISELQSQIEELKMQLSKKDDEQQMMQARSEEEVSHKNNALKQIRELQAQLSELQEDLESE
KQARNKAEKLKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKAIEEETKNH
EAQIQEMRQRHGTALEELSEQLEQAKRFKANLEKTKQSQETANKELASEVKSLQQAKQES
EHKRKKLEAQLQEFMARVTEGERSKGELAERSHKLQTELDNVSTMLEDAERKGIKLAKDV
AGLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNTLQEQQEEDEEARKNLEKQMFTLQ
AQLSESKKKLEDDVGTIEGLEETKKKLQKDLELANQRLEEKTIAFEKMEKTKTRLQQELD
DLTVDLDHQRQIVSNLEKKQKKFDQMLAEEKSISARYAEERDRAEAEAREKETKALSMAR
ALDEALEAKEELERINKQLRAEMEDLMSSKDDVGKNVHELEKSKRTLEQQLEEMKTQLEE
LEDELQATEDAKLRLEVNXXXXXXXRR
Download sequence
Identical sequences I3JNJ8
ENSONIP00000010442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]