SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010448 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010448
Domain Number 1 Region: 614-799
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.76e-54
Family Nucleotide and nucleoside kinases 0.0000000357
Further Details:      
 
Domain Number 2 Region: 386-484
Classification Level Classification E-value
Superfamily PDZ domain-like 1.04e-32
Family PDZ domain 0.00004
Further Details:      
 
Domain Number 3 Region: 491-638
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-27
Family SH3-domain 0.0000353
Further Details:      
 
Domain Number 4 Region: 247-347
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-27
Family PDZ domain 0.0000534
Further Details:      
 
Domain Number 5 Region: 133-245
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-26
Family PDZ domain 0.0000463
Further Details:      
 
Domain Number 6 Region: 4-46
Classification Level Classification E-value
Superfamily L27 domain 0.0000165
Family L27 domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010448   Gene: ENSONIG00000008304   Transcript: ENSONIT00000010457
Sequence length 802
Comment pep:known_by_projection scaffold:Orenil1.0:GL831774.1:20241:61428:-1 gene:ENSONIG00000008304 transcript:ENSONIT00000010457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLKREDTERALQVMEACQAGATDGVKGRAEKLLNIFQSDLFQALLXDVQKLEMMSVTES
QSSGAPVQPWQQKYRYQDDETPPVDPSPGHMTQGRSVELSFVGMGSKRHVDGLDVYTRQF
TVREAAPAVSCLDHLNVSQTETLLHEDDDDEEEDGELTAQKGNSGLGFSIAGGTDNPHIG
DDPSIFITKIIPGGAAAQDGRLRVNDSIVFVNDVDVREVTHSIAVEALKEAGPVVRLYVL
RRRPPSERITQIKLMKGPKGLGFSIAGGVGNQHVPGDNSIYVTKIIEGGAAHRDGRLQIG
DKILAVNHMSLEDVLHEDAVSALKNTGEVVYLKVATPTSQYIHPIDRYSPPDLTSSYMEP
DYMCDYPQALPPPSPRRYSPIPRGMMGEDEYSREPRRVCVQRGSTGLGFNIVGGEDGEGI
FISFILAGGPADLSGELRKGDQILSVNGVDLRYATHEQAAAALKNAGQTVTIVAQYRPEE
YSRFEAKIHDLREQMMNSSSGSLRNSRTFYIRALFDYDKQWDCGVLSQALDFNFGEVFHV
IDSADDEWWQARRVNQQGELEELGYIPSKHRVERKEWSRMKSKGNVFLLLLAGREGFVHS
YELITQIEVDYARPIIILGPTKDRVNDDLLSEFPDKFGSCVPHTTRPRRDYEVDGRDYHF
VASREQMERDIQSHRFIEAGQYNNHLYGTSVQSVRQVAEQGKHCILDVSANAVRRLQAAQ
LHPIAIFIRPRSLENILDLNKRLSEEQARKALDRAIKLEQDFLECFTAIVHGDSFEEVYH
HVKVVIEEQSGPYIWVPARDRL
Download sequence
Identical sequences I3JNK4
ENSONIP00000010448 ENSONIP00000010448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]