SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010724 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010724
Domain Number 1 Region: 11-107
Classification Level Classification E-value
Superfamily DEATH domain 8.01e-20
Family Caspase recruitment domain, CARD 0.013
Further Details:      
 
Domain Number 2 Region: 1018-1157
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000202
Family Nucleotide and nucleoside kinases 0.0022
Further Details:      
 
Domain Number 3 Region: 697-777
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000173
Family PDZ domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010724   Gene: ENSONIG00000008528   Transcript: ENSONIT00000010733
Sequence length 1162
Comment pep:known_by_projection scaffold:Orenil1.0:GL831154.1:3312941:3333845:1 gene:ENSONIG00000008528 transcript:ENSONIT00000010733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENGTCDDVEALWEKVESQRYNLCSTITPSKLTPYLRQCKVLDELDEDEILNSLVLATKT
NRTSRLLDILHTKGERGYVAFLESLEFYYPDLYKLVTGKEPTRRFSTIVVEEGHEGLTQF
LMNEVTKLQQQSKVKTLQHAELNKKFVTLEDEKRKLKLANQELQAFQQRYNKLREERNTY
SDELLRVKDENYKLAMRYATLSEEKNMAVMRSRDLQLEIDQLKHKLNKVEEECKMERRQS
LKLKNDIENRPKREQIFELERENEMLKIKLQELQSIIQPGPLPESDKAILDILEHDRQEA
LEDRQDLVNRLYNLHEEIRQAEELRDKYLEEKEDLELKCSTLQKDCEMYRNRIDTIAVQL
DEVEKERDQAFRARDEAQHQFSQCLIDKDKYRKQIRELEERSDELHLESVRKDAKLVTLE
SRLRRMSKDINLDQSLPRDLPPSIISQGEDCKLVQGQSECSSDESPDDKFFSEEPRLKRR
LNLKAGNRVKSPVSLLKDFPINSENSHPAASAPTNGGNFLEINVPNYGNSSSLPPSPSIP
ISPTYPPSSAPPLTCSSSSSQLMFSTVDSPSNRHMLRCRNDSILSTLPEPPEKASLYRRE
REKEHDFYPRSISDFDSDNMEMELEDERGPPSVHSSSSSHQSEGMDTYDLEQVNNIFRKL
SLERPFRPSLSSFSRLSGSLKPVQELSLQGDNLLKDIRLIGGNDSGIFISYVQSGSNAEK
AGLREGHHLMFLEGCIRGENQSISLETSTQEEAHWTLQHCSGPITLHYRASHDSYRRLQS
NLADGTLASGDSFYIRVNLNISGQSDSCSLSVRCDEVVHVLDTRHQGRCEWQCARVDPYS
GSDLAERGTIPSYSRAQQLLLVKIQKLVYRGGKEENEIQRNNRNNLQPEETSHSPDPRAS
PRLSRASIFLTQILQFVSRVDIKYKRMNSNERVRIINSGSTTLPRQGFEVLRPEDAADGD
GELSRSLSLIPYSPVTLQRTQRRRPVLFTPAALAKTIIQKILNMGGAMDFNICKPDSLTK
EEFHLKQNVEPFIHYKEKQATFECITRENIEAVAAKGKHCLLEAELSCVKDLLRREIYPI
IIYVKICDKNVKKLRKLPLRVESEEDFVKLCRAKEKELEGIPCLYATLEPEAWAGTEDLI
RVIKDRILDEQKKTIWVEQDLL
Download sequence
Identical sequences I3JPD0
ENSONIP00000010724 ENSONIP00000010724 XP_003443272.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]