SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010905 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010905
Domain Number 1 Region: 54-184
Classification Level Classification E-value
Superfamily Bromodomain 1.83e-42
Family Bromodomain 0.00023
Further Details:      
 
Domain Number 2 Region: 364-486
Classification Level Classification E-value
Superfamily Bromodomain 2.09e-39
Family Bromodomain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010905   Gene: ENSONIG00000008676   Transcript: ENSONIT00000010914
Sequence length 823
Comment pep:known_by_projection scaffold:Orenil1.0:GL831154.1:4918762:4930845:1 gene:ENSONIG00000008676 transcript:ENSONIT00000010914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAVNPPHDSSLVGLSGGMMDQHTSSGKRIRKPSLLYEDFESPSLPHTMPQGPPAPPQP
PVKDPTRPGRMTNQLQYLQKTLMKSLWRHHFAWPFQEPVDAYKLNLPDYHKIIKQPMDMG
TIKKRLENNFYRSASECIQDFNTMFTNCYIYNKPTDDIVLMAQSLEKIFLQKVAQMPEEE
VELPPPAPRNKNSRGRGRKSSVVGGASRAQQVPAVSQSAYSPSSSDTGDSMLANSPQTVL
TKSLPPANIMGLPPTQPTTKKKGVKRKADTTTPSTMGFTTVGMSGTPHMVGLGKGGHGGQ
IHDTSMHTVSSMGSISLETPPGIGLVRSPGGPVLLQPMMAGTGRRVGSGRPIKPPKKDLP
DSVQPQPSRKGKLSPQLRYCSGLLKDMLSKKHAAYAWPFYTPVDAAALGLHDYHDIIKCP
MDLSTIKRKMDCREYRDAQQFASDVRLMFSNCYKYNPPDHDVVGMARKLQDVFEFRFAKM
PDEPHMEHTAMSMSGHQTSSSSSSSSSSSSSSSTSESEPSSESEESESSPSSDSEEERAH
RLAELQDQLRAVHEQLAALSQGPIVKPKKKKEKKDKKEKKKKKKLEKRNRGVRSRAGSEE
WKMPSKLKSKSAKAGGSQAKKSQGKKSNKNSKTSKKPFYPPLATSMLPHYDSEEEEEIVP
MSYDEKRQLSLDINKLPGEKLGRVVHIIQSREPSLRDTNPEEIEIDFETLKPSTLKELER
YVMTCLRKKPRKPYAEQAAKKGSIGKSKEELTLEKRRELERRLQDVSGQLNSVKKPTKPK
VEKPSAVETHAQPSRLSGSSSSSDSSSSSSSSSSSDSSDSDSS
Download sequence
Identical sequences I3JPW1
ENSONIP00000010905 ENSONIP00000010905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]