SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011094 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011094
Domain Number 1 Region: 399-645
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.33e-89
Family ABC transporter ATPase domain-like 0.000000731
Further Details:      
 
Domain Number 2 Region: 1060-1306
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.57e-85
Family ABC transporter ATPase domain-like 0.00000158
Further Details:      
 
Domain Number 3 Region: 38-80,126-390
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 1.02e-63
Family ABC transporter transmembrane region 0.00027
Further Details:      
 
Domain Number 4 Region: 734-1050
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 1.44e-60
Family ABC transporter transmembrane region 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011094   Gene: ENSONIG00000008821   Transcript: ENSONIT00000011103
Sequence length 1312
Comment pep:known_by_projection scaffold:Orenil1.0:GL831187.1:1806559:1816154:1 gene:ENSONIG00000008821 transcript:ENSONIT00000011103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKKVSLTSPSLADKEADSQNGEEKKKENALSIGYFQLFRFATWKDIVMMVVGSVCALVH
GAASPLMLLVYGMMTNTFVDYEREVQELKDPNKTCNNNTIYWVNGTVYETDENTTLYCGV
DIEAQMTLFAYYYVGIGFGVLIVSYFQIAFWVTAAAKQTQRIRKTYFRKVMRMEIGWFDC
NSVGELNTRISDDINKINSAIADQVSIFIERISTFIFGFMVGFIGGWKLTLVVIAVSPLI
GIGAGLMAMAVARLTGRELKAYAKAGAVADEVLSSIRTVAAFGGEEKEAERYDRNLVEAQ
NWGVKRGTIIGVFQGYLWCIIFLCYGLAFWYGSKLVIDTKEMTAGTLIQVFFGVLMAAMN
LGQASPCLEAFASGRAAAKSIFETIDREPEIDCLSEEGHKLDKVKGDIEFHNITFYYPSR
PDVKILDNLSMQIRAGETTAFVGPSGSGKSTTVQLIQRFYDPKEGTVTLDGHDIRTLNIQ
WLRSLIGIVEQEPVLFATTIAENIRFGRPGVTMEDIIQAAKEANAYNFIMELPQKFETMV
GEGGGQMSGGQKQRIAIARALIRNPKILLLDMATSALDNESEAVVQEALDNVRTGRTTIS
IAHRLSTIRNADVIIGFEHGQAVERGTHSDLLGKQGVYFTLVTLQSQGQTNTTSDVISEA
PEEDFDLKAGGFSRGSRRSSKRSSLRLRSWSQLSNDFVPDALSGSLKIATDTNITSENQR
NDAEEHVEPAPVARILKYNQQEWPYMLLGSLGAAVNGSVNPVYAILFSQILGTFAIQDLN
EQRKQINGICVLFCVVAVASFISQFLQGYSFAKSGELLTRRLRKVGFQAMLKQEIGWFDN
PINSPGALTTRLATDASMVQGATGSQIGMIVNSVTSIGVSFIIAFYFSWKLTLVILCFLP
LIGLSGVFQAKMLTGFANEDKKAMEEAGQVSSEALANIRTIAGLAKESSFVDSYEQKLES
PYKSAKKKANIYGLCFGFAQCVIFMAYAASFRYGGFLVRAEGLQYMFVFRVISAVVISGT
ALGRASSFTPDYAKAKTAAAQFFKLLDRVPKISISQSDGEKWENFRGEIHFLNCKFTYPT
RPDTQVLKGLRVSVKPGQTLAFVGSSGCGKSTSVQLLERFYDPDEGQVVIDGVPSHSVNV
PFLRSQIGIVSQEPVLFDCSIAENIQYGDNTRSVSMEEIIEASKKAYLHDFVMTLPDKYE
TQVGAQGSQLSRGQKQRIAIARAIVRNPKILLLDEATSALDTESEKTVQTALDEARKGRT
CIVIAHRLSTIQTADIIAVMSHGAVIEQGTHDKLMAKRGAYYKLVTTGAPIS
Download sequence
Identical sequences I3JQF0
ENSONIP00000011094 XP_005453019.1.78416 ENSONIP00000011094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]