SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011121 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011121
Domain Number 1 Region: 209-273
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000119
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 878-998
Classification Level Classification E-value
Superfamily Bromodomain 0.0000000000000327
Family Bromodomain 0.0022
Further Details:      
 
Domain Number 3 Region: 795-856
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000175
Family PHD domain 0.0037
Further Details:      
 
Domain Number 4 Region: 49-76
Classification Level Classification E-value
Superfamily RING/U-box 0.000000707
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011121   Gene: ENSONIG00000008845   Transcript: ENSONIT00000011130
Sequence length 1036
Comment pep:known_by_projection scaffold:Orenil1.0:GL831160.1:4560364:4572832:-1 gene:ENSONIG00000008845 transcript:ENSONIT00000011130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRLEEQKLFPMDAMEKLESGHTAVLSGENEAESTREERSGALDQHDLDTCPVCHLSFHSK
EPKLLPCLHTFCERCLPLPSRNLDVTEPSVSQSDNGATKPHTDQGPINACQPFLQPVNVI
RCPVCRQECMAADVLDNMFVKESFEAPSSTVERAVQLCMTCDDNTEAAGFCVECVEYLCT
TCVEAHQRVKFTKDHMIRQKSEVSQDVCVVSNQRPMFCHIHKQEPLKLFCETCDLLTCRD
CQLTKHKDHSYQFLEDAYKNHKEHMERMTHQLQEKKKLIEEVSDSINSGLLLVEQNHTSV
RDEIKKSVSNLILEINKKGKILLDQLEAVTKDHESLLRKQQKDIGYLSQHLDHVIDFIKW
ATAKNGGTALLYCKRLILFQIENLLQAKCSASFVPQSTIRFQCRASYWASNVDLGKRLTN
DVIHSPENEWIICFLLQHEHTHSGQSSSGSPHSFALGAPHSTLAQLQMQVDKLNPQAHWQ
PQPPPPPCTWYQSIQLQQTVPGPLQRGSPSHSLPPQPDHRFTRPLPNHVSSTRSILSPGF
SPQVTVHFFVSEVGQYWHVKCRHLFSTDVNKLLKLHTKLVVKKQQSYQQRRTGSGSTYQT
KPIDGFFSTPFYAQITPPPLSGSVSLPHSQQRTEPTYMNRGNDSAGPVYTVKPNYPQGAE
TSLSSRNAPGHHTPVSQKKTRKAPEIHQASGAVGSAAKKRQRSSPRPIIIIKDEPDDESS
GQVQYWCLLIVTSLSHNFMQAAGSRRTQVHPKQRASLPDSTDDQPQINSQGEPLGQSKTR
PPNHVSSVGEQQQVEQNKVQLEDSNETSCAVCQTTGELLCCQKCHKAFHLTCHVPALLRS
PSREWFCTFCCDLLLPEMEYVCKPEAKTIKKEMDFEGAFSPVDKQKCERLLLYLFCSELN
SVFHKSASLSVHADNSLTIKGPVSFSTVKNRLEAEQSMCYQSPAEFVLDIRLIFGNCVAC
SECRSNTELAVTCRRFKELFEDYLKLIYPDQTFPEIKPEMIQTASPECQDSQLKSLDNIV
PLAKRQRTFSDSQDAP
Download sequence
Identical sequences I3JQH7
ENSONIP00000011121 ENSONIP00000011121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]