SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011234 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011234
Domain Number 1 Region: 2043-2151
Classification Level Classification E-value
Superfamily Bromodomain 3.53e-34
Family Bromodomain 0.00013
Further Details:      
 
Domain Number 2 Region: 1901-1966
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.54e-16
Family PHD domain 0.0024
Further Details:      
 
Domain Number 3 Region: 737-788
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000017
Family Methyl-CpG-binding domain, MBD 0.041
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000011234
Domain Number - Region: 1129-1224,1260-1313
Classification Level Classification E-value
Superfamily ARM repeat 0.0317
Family MIF4G domain-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011234   Gene: ENSONIG00000008939   Transcript: ENSONIT00000011243
Sequence length 2152
Comment pep:known_by_projection scaffold:Orenil1.0:GL831187.1:2444323:2491762:1 gene:ENSONIG00000008939 transcript:ENSONIT00000011243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGRPLASSPAPFSLHMASSSASSSPAPPQKLHTKSRATPSPKVSSPITISVILSYFRQ
SKKNIIGHSLRIMEDECLNMSVSPNGLNLANSPVALNASSSSCSEFGGLGCLGLSALAAP
SQLGTFPDWWRTSETQARGAAAFFPPLLGLHPFVLSTFKSHDPVDLQSRPSGKRSLEKCV
NGTVNGRSASSPAGNAPAMNTSSLLAKGKKETPQANSHEPGQLHQKAVEKANQKVNIWSN
TITIKKPNKRPLETSSMSGSQSESQSESSSDVEESSSDPDDMEEEDDDDQSSDSEESDYE
KQSPVGAEMTFCLLCLPHPPTQRLTHNTPESKKKRPCTVDGSSTQHPQSYSSPAGLLQSA
ALFLQRPRTSEEEGQQHTSVIQATGLAVSNSPLPQSQREACPLPFRSSPSPISFSSSSKH
LAALTSAKRFHPSSSPKHASVSSSPKPLALCSTKKSLSQCSPLKRLCSPKPPFPSSLPKP
QTLLASKVNLYPNGAINGAVQDAPLALITRPRIQSSAPNSKPLLAATSPPCSMPINLSTG
TKEMLDSSASPLKTSASSEPRSRKTTKTVHSGKSLTRTNTSCLPVDLVRGSVPDIHSSKN
SDDSLGDDYDDDEDEDSGSSFSGGTLESPTESESILGSDSDAFEDDVKESVETEADSDAE
RSPLKLAQTSSSTQKSSSSLSAASSLLNIQITKPPSLHSSFLSPTTSTGAMGKQSAPSPP
FTFASQPGSGRRRRVTDERVLRLPLEFGWQRETRIRTVAGRLQGEVAYFAPCGKKLRQYP
DVVKGLQWFLLAEEEIAPSIIAMDGRRSRRTKSEHQPTGDSTGAIQWKPYPLNGGENNFQ
DVSDAKLLRKLEAQEIARQAAQIKMMRKLEKQAIAQAAKEAKKQQAIMAAEERRKKREQL
KILKQQEKIKRIQQIRMEKELRAQQILEEKRKKREAAASARILEAEKRNKEREMRRLQAV
ILKHQELERHRLDMERERRRQHMILMKAVEARKKAEEKERLKKEKKDEKQLNKERKLELR
RLELEKAKELKKPNEDMCLADHKPLPELSRIPGLVLAGSTFSNCLMVLQFLHSFGKVLGL
DLNSDPLTIGDLQEGLLNIGENMEKVQDLLVTMLSAAVCDPGVPAGHKSKTILGDHLTNV
EINRDNVSEILQIYMEGHSEQKEVAMLAFSLRTKPFQAHSPSQKASVLAFLVNELCCSKA
VISEIDKNIDYMTNLRKDKWVVEGKLRKLRSIHTKKTGKKDNSWAGENNHAFVLPSVQNK
SKRKEGDSEEEEDEDDDSEDQRDDEEEEEEEAGGKRGKKTDICEEEDDSVRSASIEELEK
QIEKTYKQQSQIRQKLFDSSHLLRSVMIGQDRYKRRYWVLPQCGGIFVEGTESSEGCEVE
EEERRRQWATEVIRVKEEQLEETKPVVSSCTQSTDSDTTMPESQQDKDNLFLQKPGSLSK
LSKLLEVGKMGQDSDINTQNSHSVKVPTTASYPSYPASQIVPTQQGLMDKLDTAVPFLLS
ATQLKSIHWVTQSPQSRLHYEHLSKTLTEKSSQWFSLFPRSPCDESSVTSGSSPPVSSSS
PQPIRTKSPSFLSTNPSATDSYNSTPGISNTELPIFQQVKSGIHEGRLTQHDMSSSVASP
SLPFSGTPLPPMVDLASQHAEGHGNEASFLENNSINKSETSESPSDKSTCASYAAIEGAK
TQDYPYPRPIPEEMLRGWWRVSDMENLHSLVKTLHCRGIREKALQKQIQKHMEHMTKLCE
NSKDDVLAAIGVTGMEKQEVSKEAVESWCAEEKAMEVDIRLLRQVEALERKVISASLQVK
GWMHPEPQSDSKDLVYHEHKPFSSLAQENKRERDASQEDVPGSVVRRPNNPLDIAVTRLA
ELERNIERSSEEEAAPGMRLWRKSLGQVRSSAQLSLCIQQLQKSIAWERAIMKVHCQFCQ
KGDNEELLLLCDGCDRGCHTYCHKPKINTVPDGDWFCPACESKESGQYPHSRKQQSRTAG
GGKKSGEGKRSIKPSVEGELISEEDARSNSVPKKGTKEVKKRKGDDSPLGSQAKFDSPIY
CAKKAKTHKDELGICRVLLAELEAHQDAWPFLTPVNHRAVPGYRKVIKKPMDFSTIKEKL
TSNQYLNLETFIIDVNLVFDNCERFNEDDSEIGRAGHRMRRFFDKRWTELLQ
Download sequence
Identical sequences I3JQU0
ENSONIP00000011234 ENSONIP00000011234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]