SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011239 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011239
Domain Number 1 Region: 526-716
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.72e-55
Family Nucleotide and nucleoside kinases 0.0000000697
Further Details:      
 
Domain Number 2 Region: 267-364
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-32
Family PDZ domain 0.0000436
Further Details:      
 
Domain Number 3 Region: 14-117
Classification Level Classification E-value
Superfamily PDZ domain-like 1.05e-28
Family PDZ domain 0.0000647
Further Details:      
 
Domain Number 4 Region: 367-483,521-555
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-28
Family SH3-domain 0.00024
Further Details:      
 
Domain Number 5 Region: 121-213
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-26
Family PDZ domain 0.0000778
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011239   Gene: ENSONIG00000008942   Transcript: ENSONIT00000011248
Sequence length 719
Comment pep:known_by_projection scaffold:Orenil1.0:GL831248.1:2195748:2240055:1 gene:ENSONIG00000008942 transcript:ENSONIT00000011248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QANPPPVVVNTDSVDTPPYVNGTEADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSI
FITKIIPGGAAAQNGRLRVNDCIVRVNETDVREVTHSGAVEALKEAGGLVRLCIRRRRSL
TERILDIKLVKGPKGLGFSIAGGVGNQHVPGDNSIYVTKIIEGGAAHKDGRLQIGDKLVA
VNGSCLEEVTHEEAVAALKSTPDVVYLRVAKHTSLFINDNFPPPDVTNSYSPHQDNHISP
YMSGSQSVSPAPLTTPRYSPLPRSIAGDDDITREPRRVVLQRGSTGLGFNIVGGEDGEGI
FISFILAGGPADLCGELRKGDRILSVNGVDLSSATHEQAAAALKNAGQTVTIVAQFRPDE
YSRFEAKIHDLREQMMTSSVSSSSTSLRSTQKRTLYVRALFDYDGSASDLSVPNQALPFH
FGDILHVSSASEEEWWPARHLSPPPPNCPEVGVIPSRRRAEKKERSRLKTVRVSRSQDRS
DSIKGDFQNAKLKKKLVTSGTSDNESSSSGQEEIFLTYQPVMQHEVNYTRPVIVLGPMKD
RVNDDLISEFPDKFGSCVPHTTRPRREYEVDGRDYHFMSSRELMEREIQEHKFIEAGQYN
NHLYGTSIQSVKEVADKGKHCILDVSGNAIKRLQMAGLHPIAILIRPLSVDNILEMNKRL
SEEQARKAYDRAVKLEQEFTEYFTAIVQGSTLEEVYSQVKQIIEEQSGPYIWVPTKERL
Download sequence
Identical sequences I3JQU5
ENSONIP00000011239 ENSONIP00000011239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]