SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011243 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011243
Domain Number 1 Region: 851-1213
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.46e-71
Family Ankyrin repeat 0.0000171
Further Details:      
 
Domain Number 2 Region: 1233-1363
Classification Level Classification E-value
Superfamily TPR-like 7.83e-23
Family Tetratricopeptide repeat (TPR) 0.0017
Further Details:      
 
Domain Number 3 Region: 299-386,497-562
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000375
Family Extended AAA-ATPase domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011243   Gene: ENSONIG00000008945   Transcript: ENSONIT00000011252
Sequence length 1822
Comment pep:known_by_projection scaffold:Orenil1.0:GL831187.1:2513616:2642812:-1 gene:ENSONIG00000008945 transcript:ENSONIT00000011252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKAVLKKNRDGGKGSKKDSGPVRKPKYVESPRVPSDAIVSARRKATDNKESSHNDLQAE
KQPSSSSPATQELMTRLGFLLGEGIPGTARIPMDDKNEKKCSLTSQGISPCSTLTSSTAS
PSTDSPCSTLNSTTSRPPLSRSSPCGTITSPSSTLESKDSGIIATITSSSENDDRSGSSL
EWSKDGSLRGSGRHGLAQSVRADTCSPVAEEDSSSATATPADTPSSHSPEGPIAYPPQTS
ASLMMPRPNSVAATSSTKLEDLSFLDEQRNTPLRTSIRLPWHNTGGRPPQDAKARFAPYK
PVDIMLKPLLFEVPSITTDSVFVGRDWLFQHLEDVLKAGESTENHGAVVVGSVGYGKTAI
ISRLVALSCHGGRMRQIASNSPSASPKTGPGQSTELPLSQPPQPTPPSSAANTLRTSSCP
GTPEMQRHREEAVKRLAAKVVAYHYCQADNTYTCLVPEFVHSIAALLCRAHQLSAYRELL
LKEPHLQSMLSLRSCVQDPMAAFRRGVLEPLANLRKERRIPEEDYIILIDGLNEAEFHKP
DYGDTIASFITKIIAKFPSWLKLVVTVRINLVEITSLLPFSKISLDDFSDNKEISNDLNA
YIQYRINGSKDIMNNISLNGKADPITVGKLSSHLISRSQGSYLYLKLTLDLFERGHLVIK
SASYKVVPVSLAELYQLQCNMKFMTNSAFERSLPILNVSLASLHPLTDEQLFNAINAGFV
QGELQWEDFQQRMELLSCFLIKRRDKTRMFCHPSFREWLVWRADGESTDFLCDPRTGHAL
MAFMLSRQEGKLNRQQTMELGHHILKAHIFKGLSKKTGVSSSVLQALWINCSTDGLSAAL
ASLRNLYTPNVKVSRLLMLGGANVNYRTEVLNNAPVLCVQCHLGHQEIVSLLLEFGASVD
VVSENAMSPLCFSAAAGHLGQVMLLCKKGAKVDHVDKSGQCALVHAALRGHLEIIQYLLE
LEWSAEGQQQDCSLKSKALQQALIAASSMGHTQVVRGLLALNNEHAVQIDSHDTLWGETA
LTAAAGRGKMEVCSFLLEQGAVVQQVNRRGVSPLFCVVRQGHWQIAELLLQNGADINISD
KQGRTLLMVAACEGHLSTVEFLLSKVGLKGASLTSMDKEGLTPLSWACLKGQKNVVQFLV
EKGAVIDHTDKNGRTPLDLAAFYGDAEIVQYLVERGAVIEHVDHSGMRPLDRAIGCRNTS
VVVTLLKKGAKLGNAAWAMATSKPDILIILLQKLMEEGNLLYKKGKMKEAAQRYQYALRK
FPREGFGDELKAFKDLRVSLYLNLSRCRRKTNDFGMAEEFATKALELKPKSYEAYYARAR
AKRSSRQFTAALADLHEAAKLCPNNREIRRLLARVEDECKQMQRTQTKGGLGGAAAASSQ
ASGGHESDQEQDEGQEDPSEHSLARSVEGQREILEEEEEEEDAMQHDRTVLPSESATASN
SVGHQNQSLSPSSPPGPSRLPPHRYPREHREALPQQGLVLQPTKQAQIVKTNQHTGGGAV
GGRSAGAKSQYAPSSPLPSRHMSSMLKPGPGIDIGPLPPPADEPMYGNRMLLAAASSSMA
HSCESESLHSSQASYSSSSNSKGLGQDRLSAHSASSLDGLACSGPGFQGNHSESGKEGMC
APAGSQGGGSSSSMRVSSSTSSLASSSSLSDSGKLGPDVRTKITDKTKHSQQGSAAAEYK
PRPFMGITDKTARFQQQSHPSLQSIGRSWLNHSSDGLVCHNMSTMGLQSVDGKTASSYQE
QHKPPPPQGGMAMSSLQNGMHAKEFAEKFCQAANCYKESKPALAMPHTLMDSKPKQPGLA
RDNPAIHVASMKPKRSFIESNV
Download sequence
Identical sequences I3JQU9
ENSONIP00000011243 ENSONIP00000011243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]