SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011365 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011365
Domain Number 1 Region: 304-365,461-618
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.49e-48
Family Tandem AAA-ATPase domain 0.0012
Further Details:      
 
Domain Number 2 Region: 179-407
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.6e-38
Family Tandem AAA-ATPase domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011365   Gene: ENSONIG00000009036   Transcript: ENSONIT00000011374
Sequence length 671
Comment pep:known_by_projection scaffold:Orenil1.0:GL831187.1:3482066:3491648:-1 gene:ENSONIG00000009036 transcript:ENSONIT00000011374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVRGRCVPHTEDRFRVEVSYHAGLIAVFKSIPSKNYDPATKMWNFSLEDYRQLMEEAAAI
PSVSLRPLEGMEAVDVAEATSRARDGAALAALLKGQCILVSQTKFEVDIGYHVDVIAAFK
QMPTKSYDMKTRKWNFSLEDYKRLMDLLSGIAAVEVEPLPRAIIQAFSARFDGTEARILN
VPEADLSSIDPSLTRSLMPFQREGVNFAVSKQGRLLLADDMGLGKTIQAICIAAYYRKEW
PLLVVTPSSVRFTWAEAFRRWLPSLTPDSINVVVKAKDSLRSGLINIISYDLLSRMDKQQ
PGNPFNVLIMDESHFLKNMKTARCKAALPLLKVAKRVILLSGTPAMSRPAELYTQILAVR
PTLFPRFHEFGIRYCDARQMTWGWDYTGSSNLGELKLLLEECLMLRRLKSEVLSQLPAKQ
RKVVTVTIDGINTRTKAALSAAAKQLAKGHRNKMEEKEALLVFYNHTAEAKLQAIMEYIT
DMLECGREKFLVFAHHKLVLDHITTELEKKNVDFIRIDGSTPSAERQQLCERFQYSAKTC
VAVLSITAANMGLTLHSADLVIFAELFWNPGVLIQAEDRVHRIGQTSSVNIHYLVAKGTA
DDHLWPMIQEKMNVLEQVGLSESNFSETAENTSFHSKDPTQRSIMEMFQRSFSEDDDMDE
AILLEAANDWE
Download sequence
Identical sequences I3JR71
ENSONIP00000011365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]