SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011474 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011474
Domain Number 1 Region: 24-250
Classification Level Classification E-value
Superfamily RNI-like 5.76e-54
Family 28-residue LRR 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011474   Gene: ENSONIG00000009126   Transcript: ENSONIT00000011483
Sequence length 256
Comment pep:novel scaffold:Orenil1.0:GL831379.1:514639:528294:1 gene:ENSONIG00000009126 transcript:ENSONIT00000011483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMDKEENRAESGEPRPTRQTSSGFSETHCEVMASSLSSPSHLTELDMSGNTLQDSAVKL
LCAGLENPNCRLETLGLVSCGLSEISCDYLAAALKSNPSYLRELDLRLNNKLQDSRVKHL
CGFLESPGCGLETLRLGSCGLSEISCDYLAAALKSNPSHLRELDLSNNSLQDSGVEQLCG
FLESPGCGLETLRLWRCGLSERSCDYLAASLKSNPSHLRELDLSNNNLQDSGVKQLCGFL
ESLGCGLETLRSVTMI
Download sequence
Identical sequences I3JRI0
ENSONIP00000011474 ENSONIP00000011474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]