SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011496 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011496
Domain Number 1 Region: 78-363
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-84
Family RecA protein-like (ATPase-domain) 0.0000483
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000011496
Domain Number - Region: 369-429
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0416
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011496   Gene: ENSONIG00000009144   Transcript: ENSONIT00000011505
Sequence length 470
Comment pep:known_by_projection scaffold:Orenil1.0:GL831300.1:941086:965650:-1 gene:ENSONIG00000009144 transcript:ENSONIT00000011505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PISAYSTVSGVNGPLVILDNVKFPRYAEIVHLTLPDGTKRSGQVLEVIGSKAVVQVFEGT
SGIDAKKTACEFTGDILRTPVSEDMLGRVFNGSGKPIDRGPTVLAEDYLDIMGQPINPQC
RIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVQKSKDVMDY
SADNFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTA
EYLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVE
GRSGSITQIPILTMPNDDITHPIPDLTGYITEGQVYVDRQLHNRQIYPPINVLPSLSRLM
KSAIGEGMTRKDHADVSNQLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFEKNF
IAQGPYDNRTVYETLDIGWQLLRIFPKEMLKRIPQSTLAEFYPRESAARH
Download sequence
Identical sequences I3JRK2
ENSONIP00000011496 ENSONIP00000011496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]