SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011617 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011617
Domain Number 1 Region: 973-1107
Classification Level Classification E-value
Superfamily Bromodomain 8.24e-25
Family Bromodomain 0.00062
Further Details:      
 
Domain Number 2 Region: 287-351
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.83e-17
Family B-box zinc-binding domain 0.002
Further Details:      
 
Domain Number 3 Region: 893-953
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000908
Family PHD domain 0.0033
Further Details:      
 
Domain Number 4 Region: 141-221
Classification Level Classification E-value
Superfamily RING/U-box 0.0000216
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000011617
Domain Number - Region: 216-261
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0691
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011617   Gene: ENSONIG00000009236   Transcript: ENSONIT00000011626
Sequence length 1146
Comment pep:known_by_projection scaffold:Orenil1.0:GL831205.1:2466437:2497220:1 gene:ENSONIG00000009236 transcript:ENSONIT00000011626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNKGEEDMETSAKSDSVPSLQDTEPPETKNDNAVIVIETNTKGDEESESRENANEAPT
PSSEGGDVSSSSSSSSSGAAGAGGETNGSASPAGTSSTNAEPTAAEAVGDAPVGGLAAEM
SPPPAASAATPVSTPINLLDTCAVCKQSLQSRDCEPKLLPCLHSFCLKCIPQPDRQISVQ
VPGPHGQTDTHIVNVMRCSVCHQDYKQSDIIDNYFVKDTTEATSTSDEKAAQVCTSCEDN
AGTIGFCVECGEWLCKTCVEAHQRVKITKDHKIRTKEDADAASESVSTSGQRPVFCPIHK
QEPLKLFCETCDTLTCRDCQLLEHKEHRYQFLEEAFQNHKSIIETTMAKLQEKKNFVHYS
VSQVQSRLKELNETHRKVEHEIKIAVFTLINEINKKGKSLLQQLESVTKERSMRLVSQHK
DTTQLAQQIHHVLNFCHWAITTGSSTALLYSKRLILYQLRQLFKVRLEPAPQANGVVRFF
CDPTFWAKNVVNLGNLVIEKPPSPAQPPGTVMVGGPPISPVQGHPSKHPGQINLAQLRLQ
HMQQAAYAHQKQQQQQQQQQHQQQIQQQMRIASRQAGPPMVQQQPPRLISMQQIPRGPGG
MNGGPGPPLYPSSHHMRLPGPSPGRMPTSQPRHNGQQYPPMMQPQLQRQHSNPGHAGPFP
VASLHNANPTSPTSASMAGAHAHRSPVNPAMGSIELIPSVTNPENLPCVPEIPPIQVEHA
GTNYFEAILHRSITASKDQLNSQDPLPRQSPGSSGVPNFHTPARPSSNSSAGSRGSCSSA
GRGGPGGGAAVEQVTVKQEPGTDDSYSCPASSLKTERGKDAERSACMMISPENSPHPVLG
AVSAGQDALEALGERIKTEPQSETQSSSTTTVAPLTNGNSNKGGETKRSEASTGTGNLEG
KEDDPNEDWCAVCINGGDLLCCDRCPKVFHMKCHVPTIKIVPKGDFLCTFCRSITNPEIE
YCDESRKGKGEQDLSAEDQRKCERLLLYIFCHELSVGFREPVPSSVPNYYKIIKQPMDLK
KVKKKLQLRNSQYYQSVQEFVSDIRLVFKNCAKYNEMSRIIQVYDEEKQINTQVGSEMAI
SGKAVSLYFEEKLQEIFPGQSFPETAEPESPQEKEKEDDNTDDSEDDFIQPRRKRLKTDE
KVVHIK
Download sequence
Identical sequences I3JRX2
ENSONIP00000011617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]