SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011656 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011656
Domain Number 1 Region: 276-397
Classification Level Classification E-value
Superfamily SH2 domain 5.79e-25
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 2 Region: 401-440
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000051
Family SOCS box-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011656   Gene: ENSONIG00000009267   Transcript: ENSONIT00000011665
Sequence length 468
Comment pep:known_by_projection scaffold:Orenil1.0:GL831151.1:815806:824223:-1 gene:ENSONIG00000009267 transcript:ENSONIT00000011665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEDPSETSDALLVLEGLGSEEWDSQRADAAGAQTGRGGGGVHRSELPVLTRRSRRHRVPP
LLRGPPAPRRQHRQPLPVPARPLTTLPGWSRKGGSLKVRLSKLFRTKSSSGGSGGLLDKR
PSLASSTSSGGSLLDVWGSTCSNPDQDGRLQVSRPHSAFSPVPFTPAFTGETVSLVDVDI
SRRGGNSLHPPTPPPPPRRSLSLLEDLNVPLLTTLMMIPAGNFSLGKVFLLKSPXTHRDV
ESLPRPVPLRPDGHHPPPRLAPRCPLSRPDAGSFATSLRELEKCGWYWGPMNWEDAEMKL
KGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEF
IERAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSSVKSLQHLCRFCIRQLVRIDH
IQELPLPTPLIAYLRKFYYYDPEEEISPTLKEDKEQKEEKERVTEGGG
Download sequence
Identical sequences I3JS11
ENSONIP00000011656 ENSONIP00000011656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]