SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011741 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011741
Domain Number 1 Region: 10-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.34e-20
Family G proteins 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011741   Gene: ENSONIG00000009341   Transcript: ENSONIT00000011750
Sequence length 271
Comment pep:known scaffold:Orenil1.0:GL831151.1:1361866:1364863:-1 gene:ENSONIG00000009341 transcript:ENSONIT00000011750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGSQGSKPEAPEELRIMLIGKTGAGKTSIMNTFLGKAAVTKNSFASDEAPCTTETAPFG
NQRLVLADTLGLCHTSKSKEEVLSKLIASTFQFDSEQGPHVFLYVHRWEDGFTTHDVERV
KVLRRIFGKEAMRYFFLLITHINGDLSGGQKNQIRKFIKKVGFKTQKYCVINNRGNENRK
TKEQKELVKEINEMVENNKLRNYTKEMFEHAQEVLRNQIQKSKTQRQMGAGDQHVATVAK
ALLSPVLPADFVTVVLQANVWLATKFDNCLT
Download sequence
Identical sequences I3JS96
XP_005469208.1.78416 ENSONIP00000011741 ENSONIP00000011741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]