SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011743 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011743
Domain Number 1 Region: 13-192
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.97e-19
Family G proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011743   Gene: ENSONIG00000009343   Transcript: ENSONIT00000011752
Sequence length 224
Comment pep:novel scaffold:Orenil1.0:GL831151.1:1535011:1537393:1 gene:ENSONIG00000009343 transcript:ENSONIT00000011752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRGGREKGEKEEKTDDLRIVLFGKTWVGKSTLGDIIMGNTETFTSKDLSKDRTQKSHSTV
EGQKVVVVDTPGLFKSGKHEDELVKEIKRSIDLASPGPHVFLLVLRFGMITSEELEVLEV
FERTFGRRALAYTTVVFTHKNEEYEANIQETMIESKDFRELLERCQWRYFAFNIKDKSPA
QVTELLKKITPMGKDYFYTPEMLQEAGKPEEQEEKPKTEQAGVR
Download sequence
Identical sequences I3JS98
ENSONIP00000011743 ENSONIP00000011743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]