SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011924 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011924
Domain Number 1 Region: 35-842
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.2e-287
Family Motor proteins 3.79e-16
Further Details:      
 
Domain Number 2 Region: 956-1076
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.49e-23
Family Myosin rod fragments 0.0012
Further Details:      
 
Domain Number 3 Region: 1237-1352
Classification Level Classification E-value
Superfamily Myosin rod fragments 7.59e-21
Family Myosin rod fragments 0.004
Further Details:      
 
Domain Number 4 Region: 840-960
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.76e-19
Family Myosin rod fragments 0.00029
Further Details:      
 
Domain Number 5 Region: 1069-1154
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000889
Family Myosin rod fragments 0.0035
Further Details:      
 
Domain Number 6 Region: 1352-1457
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000497
Family Myosin rod fragments 0.0052
Further Details:      
 
Domain Number 7 Region: 1557-1662
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000654
Family Myosin rod fragments 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000011924
Domain Number - Region: 1688-1801
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00107
Family Myosin rod fragments 0.0083
Further Details:      
 
Domain Number - Region: 1464-1576
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00199
Family Myosin rod fragments 0.0091
Further Details:      
 
Domain Number - Region: 1161-1237
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00471
Family Myosin rod fragments 0.006
Further Details:      
 
Domain Number - Region: 1783-1859
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0419
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 1860-1925
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0759
Family Myosin rod fragments 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011924   Gene: ENSONIG00000009489   Transcript: ENSONIT00000011933
Sequence length 1973
Comment pep:known_by_projection scaffold:Orenil1.0:GL831151.1:3047205:3075181:1 gene:ENSONIG00000009489 transcript:ENSONIT00000011933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TANMADTDDNKYLFLENDFRNSGVAQADWAAKKMVWVPSEREGFEPASIKEEKGDQVLVE
LSNGQKVTVSKDDIQKMNPPKFSKVEDMAALTFLNEASVLHNLRERYFSSLIYTYSGLFC
VVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTGESGA
GKTENTKKVIQYLALIASSHKGKNPINPGELEKQLLQANPILEAFGNAKTIKNDNSSRFG
KFIKLNFDVTGYIVGANIDTYLLEKSRCIRQAHTERAFHIFYYMVAGAKDKMREELLLED
FSSYRFLIEGHVEIPGQEDNEMFDETLEAMDIMGFTEEERLGMLKVVSSVLQLGNIKFEK
ERNSEQATMPDNTAAQKVCHLQGINVTDFTRAILTPRIKVGREVVQKAQTKQQADFAIEA
LAKAMYERLFRWILARVNKTLDKSKRQASSFLGILDIAGFEIFEDNSFEQLCINYTNERL
QQLFNHTMFILEQEEYKREGIEWNFIDFGLDLQPCIELIERPNNPPGILALLDEECWFPK
ATDISFVDKLLNTHTGHVKFSKPKQHKDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNV
TALLNNSSSAFIQDLWKDVDRVVGLETMTKMSESSVPSSTKSKKGMFRTVGQLYKESLGK
LMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICRQGFPNRIVFQE
FRQRYEILAATAIPKGFMDGKQACNLMVKHLDLDPNLYRIGQSKMFFRTGVLAQLEEERD
LKLTVVIIAFQAQARGFLGRKAFSKRQQQLTAMKVIQRNCACYLKLKNWQWWRLFTKVKP
LLQVTRQEEEMGQKEEELKTAKEVAAKTEAELKDITQKHTQLMEERAQLELKLQAETELC
AEAEEMRVRLEAKKQELEEVLHEMEARLEEEEDRSNALQQEKKEMEQQLQLMEAHIAQEE
DAKQKLQLEKAAVEGKVKKLEEDILLMEDQNNKLQKERKLLEERMADMSSNLAEEEEKSK
NLTKLKAKHESMISDLEVRLKKEEKSRQDVEKAKRKVEAELAELHEQHADLQAQLAELRA
QLAAKEEELQATQARLEEESSQRGAAVKRIRELEALLSELQEDLEAERAARGKAEAARRD
LGEELNALRTELEDSLDTTAAQQELRAKREQEVAMLKRAMEDEGRSHEAQIQELRQKHSQ
AVEELNEQLEQAKRVRAGLEKAKQGLEKESADLSADLRSLTSAKQDVEHKKKKLEGQLND
LNSRFNESERQKNELSERVSKMTLELDSVTGLLNEAEGKNIKLSKDVSSLSSQLHDAQEL
LSEETRQKLNLSGRLRQMEDDRNSLMEQLEEETEAKRAVERQVSSLNIQLSDYKKKLDEM
SGMVELLEEGKKRLQRELEATNTEYEEKASAYDKLEKSRSRLQQELEDVLMDLDSQRQLV
SNLEKKQKKFDQMLAEERTVSCKYAEERDRAEAEVRDKETKVLALTRGLEESHEALEEAE
KTVKALRVEMEDLISSKDDVGKNVHDLEKAKRGLEAIVEEMRTQMEELEDELQVAEDAKL
RLEVNSQALKAQHERELQARDELGEEKRKQLLKQVRELESELEEERKQRSQASAGKKKLE
GELKDMEDQLEATSRGRDEALKQLRKIQGQVKDLQRELEDSRAAQKEVLASARESERKSK
AMEADIMHLNEALAAAERARKQAETERDELSEEMASNSSGKSLLSDEKRRLETKISQLEE
ELEEEQANMESLNDRLRKSQQLVDQLGAELATERSSAQSREGSRQQLERQNRELKAKLQE
LGDQGRSKLKSSITALEAKLREAEEQLEVESRERQANAKNLRQKEKKLKDLTIQMEDERK
QAQQYRDQVEKSNVRVKQLKHQLEEAEEEAQRVVAARRKLQRELDEATESNDALNREVAS
LRSKLSLGGDARNVSGVPRRGGGGAGGEVLYSSSTPRSSGSMRSLGLGGSINR
Download sequence
Identical sequences I3JSS9
ENSONIP00000011924 ENSONIP00000011924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]