SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011937 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011937
Domain Number 1 Region: 455-703
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.43e-91
Family ABC transporter ATPase domain-like 0.000000551
Further Details:      
 
Domain Number 2 Region: 126-446
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 1.57e-67
Family ABC transporter transmembrane region 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011937   Gene: ENSONIG00000009500   Transcript: ENSONIT00000011946
Sequence length 709
Comment pep:known_by_projection scaffold:Orenil1.0:GL831134.1:3262248:3270618:1 gene:ENSONIG00000009500 transcript:ENSONIT00000011946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQLLSCRANIAAAPLRPLSLHCRCNKSADLWKFSRWYTSPGSNAYSSSQQRGGAVSRIW
SLTQRAVRQSATRTSKPPGIALKFILGPAVLTVSARLFCHVAHCEADVNNNTPVEVVAKN
PVPDFKWHVLWEFVKPQLFALICAVVLAFGAAILNIQIPLMLGDLVNVVARYLRENTGNY
VHEIRGPALKLLGLYGIQGLLTSGYIVLLSRVGERVAADMRKTLFASLLRQDVAFFDANK
TGQLVNRLTADIQEFKSSFKLVISQGLRSITQTVGCFVSLYVISPKLTGLTVLVLPCLVG
AGALIGSFLRRLSRLAQEQVAKATGVADEALGNVRTVKAFAMEERELQLYAYEVDKSCEM
NENLGTGIAIFQGLSNIALNCIVLGTIFAGGTLISSNEMSPGDLMSFLVASQTVQRSLAS
ISILFGQVVRGISSGARVFEYLALQPTIPLSGGGRIPYHSLTGRVDFMNVSFSYPTRPGH
QVLKRFSLTLPPCKTVAIVGESGGGKSTVASLLERFYDPTSGVVMLDGLDIRTLDLSWLR
SQVIGFINQEPVLFGSSVMENIRFGKPEATDAEVIDAAKQANAHGFITGFPDGYNTVVGE
RGVTLSGGQKQRIAIARALIKNPSILVLDEATSALDAESERVVQEALDRATRGRTVLIIA
HRLSTIQGADLICVMSNGRIVEAGTHVELLSKGGYYSDLIRRQRAEGQK
Download sequence
Identical sequences I3JSU2
ENSONIP00000011937 ENSONIP00000011937 XP_003437910.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]