SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011954 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011954
Domain Number 1 Region: 65-328
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.81e-55
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 415-454
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000942
Family SOCS box-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011954   Gene: ENSONIG00000009516   Transcript: ENSONIT00000011963
Sequence length 462
Comment pep:known_by_projection scaffold:Orenil1.0:GL831134.1:3404685:3409011:1 gene:ENSONIG00000009516 transcript:ENSONIT00000011963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGSFVFTSMALRSLELDKDTLERYKYSKQLASHNLSSYMLKKEANNRALLKSLPPAVC
HDVVIHNALYTGDLEAMQHFFPRGSTANLIIEPQGGEMRWAARGEGLWSLTYEQELTTPL
HITAGRGFTDCLRLLLQRGADVDLAPGGTTALHEACENCQPECAKLLLMHGANANAVSED
GLMPLHVCTSHESLECAKYLLQYGAAINGCTVDEYDTPLHVAARNGLPDHTELYLRHGAA
VDKQNHEGLTSLNSACSQPQEAQDLRNYFKVCQILINAGANIHTEEQDKRTPLHMACKNA
NPDIVDLLLENGASVNDMDYGGEAPMHNILKVVAYKTSHSPERIVRSLLNHGSIRVWPGA
LPKVLMHCSKSPRTIEVLLNAYSHLKVTDTWVESVSEEVFKEYKEFYESVFSLEMTPRSL
QHLARCSLRRFLEGRVHKVVPKLDLPKFIKNYLLLDFRGYIH
Download sequence
Identical sequences I3JSV9
ENSONIP00000011954 ENSONIP00000011954 XP_003437912.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]