SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012056 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012056
Domain Number 1 Region: 1-191
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-29
Family G proteins 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012056   Gene: ENSONIG00000009595   Transcript: ENSONIT00000012065
Sequence length 288
Comment pep:known_by_projection scaffold:Orenil1.0:GL831145.1:823163:831643:1 gene:ENSONIG00000009595 transcript:ENSONIT00000012065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGLKQMRANLKSVDCIIEIHDARIPFSGRNPVFQDTLSAKPHLLILNKMDLADLSNKQ
RILKKLEKEGMTHVLFTDCLKQRDDNIKKLVPMVMDIIASKPRFNREENTNYCLMVIGVP
NVGKSSLINSLRRTNLKKGRASRVGGEPGITKAVLTKIQVCERPIMYLLDTPGVLPPKIE
SVETGMKLALCGTILDHLVGEDIIADYLLYSLNRLGKFSYVEKYDLQEPSDDIQHVLKRI
AVKLGKTQRVKAITGVGNVTITIPNYTAAAYDFIRAFRKGELGQVMLD
Download sequence
Identical sequences I3JT61
ENSONIP00000012056 ENSONIP00000012056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]