SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012212 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012212
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-76
Family PAPS sulfotransferase 0.00000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012212   Gene: ENSONIG00000009722   Transcript: ENSONIT00000012221
Sequence length 281
Comment pep:known_by_projection scaffold:Orenil1.0:GL831151.1:4990150:4993329:-1 gene:ENSONIG00000009722 transcript:ENSONIT00000012221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQYSNRLCQYKNYNFLSNSTTAEYIESLQSLEIRHSDVFLVSYPKSGTIWGQQIITSIY
ELDGHVNEYSTNSEKMPWLEFTGGAYTCRPSPRLFTSHFSHVLMPPGLMDKKAKIVYLMR
NPKDNMVSYYHFSKALADLETPESFAQFFEWYLTGNVFASSWFDHVREWYLNREQYNILF
LTYEEMILDLKASVKKICNFLGINLTEAAISQVVEKAKFENMKNDSKANFEHLPPEQFSG
KFLRKGQIGNWKNTLTVAQSERVDQVLREKLGDLPLSFIWE
Download sequence
Identical sequences I3JTL7
ENSONIP00000012212 ENSONIP00000012212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]