SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012257 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012257
Domain Number 1 Region: 213-522
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.6e-58
Family Extended AAA-ATPase domain 0.000011
Further Details:      
 
Domain Number 2 Region: 93-183
Classification Level Classification E-value
Superfamily MIT domain 2.49e-26
Family MIT domain 0.000013
Further Details:      
 
Domain Number 3 Region: 6-80
Classification Level Classification E-value
Superfamily MIT domain 1.31e-23
Family MIT domain 0.000082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012257   Gene: ENSONIG00000009758   Transcript: ENSONIT00000012266
Sequence length 528
Comment pep:known_by_projection scaffold:Orenil1.0:GL831134.1:5453117:5462699:1 gene:ENSONIG00000009758 transcript:ENSONIT00000012266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGLLMEPTNLQKAIAVAQKASEEDEAGNYEEAIRSYQHAVKYFLHILKREPQGKDGNQKI
RDKCKQYLDRAEELQEYLVNKEVITEMTAQILKYKEWRKKAIDLASKAAQEDKAQNYEEA
LRLYQAAVQYFLHVVKYEAQGDKAKQSIRAKCAEYLDRAEKLKEYLKKKDKAPAKPVKES
QSDDKGNESDEGDDPEKKKFQNQLSGAIVMEKPNVKWNDVAGLEGAKEALKEAVILPIKF
PHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSISSSDLVSKWLGESEKLV
KNLFSLAREHKPSIIFIDEIDSLCGSRSENESEAARRIKTEFLVQMQGVGNDNEGILVLG
ATNIPWTLDSAIRRRFEKRIYIPLPEEHARAFMFKLHLGSTPNSLNETDFNTLGKKTDGY
SGADISIIVRDALMQPVRKVQSATHFKRVRGPSRDDPKVTIDDLLTPCSPGDPNAIEMTW
MEVPGEKLLEPVVSMADMLRSLSNTKPTVNEQDLEKLKKFTEDFGQEG
Download sequence
Identical sequences I3JTR2
ENSONIP00000012257 ENSONIP00000012257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]