SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012311 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012311
Domain Number 1 Region: 568-674
Classification Level Classification E-value
Superfamily Bromodomain 1.23e-33
Family Bromodomain 0.00036
Further Details:      
 
Domain Number 2 Region: 216-285
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.09e-16
Family PHD domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000012311
Domain Number - Region: 326-362
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00266
Family PHD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012311   Gene: ENSONIG00000009798   Transcript: ENSONIT00000012320
Sequence length 1130
Comment pep:known_by_projection scaffold:Orenil1.0:GL831168.1:445277:455678:1 gene:ENSONIG00000009798 transcript:ENSONIT00000012320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKKARQHRVAVQRPPSPIKPSPNKQILTYAQAQRMVEFELDGRIHRLSIYDKLDVISDD
DPMVQEIMECTSNKENAEKSKQQVLLRSVRLKNKEKKNAALAIAGHVEGGGHHAGSHASP
KLPEPKFRTVEYNLPAVPKRPSAFYKYIDKTEEELDEETEYDMDEEDYAWLDLVNEKRRS
EGVSQVSHNVFEFLIDRFEKELYLESLDKGSERQAPIDDDAVCCICMDGECHNSNAILFC
DMCNVAVHQECYGVPYIPEGQWHCRHCLQLPTQPAECILCPNKGGAVKKTDDDRWGHVVC
ALWVPEVGFSNTTFIEPIDGISHIPPARWKLTCYLCKEKGVGACIQCHKANCYTAFHVSC
AQKAGLFMKMEPIKEVTETGEPTFSVKKTAYCGAHTPNGCVRRPLAIYDDSKLRNGLCKK
GDKGKGQSKGKQKQKSKSKKPEPEVESEAVPPATVPTFPAHRLQTILNQVSIQKKKVFVE
LVLSYWRLKRQSRNGLPLIRRLQTRLQSQKNVQPRQNEEESRALKEQLKEWHRLRHDLER
ARLLLELIRKREKLKREEIKLQETLLEMQLTPFSILLRALLDQLQAKDQARIFTQPVDVT
EVPDYLDHIKHPMDFSTMRKRIDAQGYNNFDQFEDDFNLIIENCMKYNSKDTYFYRAAVR
LRDQGGSLLRKARRDAEKIGFDTESGMHFADAPEVKAPPSFSWEDVDRLLVPANREQLPL
DKQLQQLLEKFDLTCAMKSSPSRSKRLKLLKKTINDVRNEMSLKRVLPSHHHCSSSSSPT
ASALFSTAPSLAELVTAKEERLKPNGHFSEDDGDKSLPPKLEPSDTIPPLIHSDTDPEPP
TLKPIDAAPDCEDKVHGKRAKLDGEIPDLLSSPACLNGHAHNSLQDPLLEGDVSVVATST
LAEPTGAVNRRTAVLFRKSKAASPQKLPRSGDEESDRTDGKEGEEEQDEDDSQLGSKSFL
SVVIPRLETLLHGKKRKHSGSRDAEEEGGEEEREESGESPVKRLDTGLPSGALQVEEQKK
VEETSRTSRPVEPRRRCASESSISSCSSLQGSTSTILSLPKCGKGKPALVRRNTVDDKSE
LIACIETGNFAKAARIAAGNVTRLSKEFKCMCGEWVDIFHRNTNNNYFKL
Download sequence
Identical sequences I3JTW6
ENSONIP00000012311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]