SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012367 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012367
Domain Number 1 Region: 1-390
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.21e-116
Family Motor proteins 0.00000129
Further Details:      
 
Domain Number 2 Region: 1257-1567
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.11e-52
Family WD40-repeat 0.0001
Further Details:      
 
Domain Number 3 Region: 940-1057
Classification Level Classification E-value
Superfamily Prefoldin 0.000000000175
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012367   Gene: ENSONIG00000009841   Transcript: ENSONIT00000012376
Sequence length 1569
Comment pep:known_by_projection scaffold:Orenil1.0:GL831168.1:1636773:1656436:-1 gene:ENSONIG00000009841 transcript:ENSONIT00000012376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIRPQLPKEKIEGCHICTYVMPGEPQVVLGKDKAFTYDYVFDMDTQQEAIYTHCTERLIE
GCFEGYNATIFAYGQTGSGKTYTMGTGFDVNIGEDELGIIPRAVNHLFRGIEERRQAATE
QGRPVPEFKINAQFLELYNEEVLDLFDTTRDLEVRKQKSNIKIHEDANGGIYTVGVTTRT
VTSAAEMIQCLKLGALSRTTASTQMNVQSSRSHAIFTIHLCQVRVCSPDNNDNATDNRLA
NDSEIDEFETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDRS
KRSTHVPYRDSKLTRLLQDSLGGNSQTVMIACISPSDRDFMETLNTLKYANRARNIKNKV
MVNQDRASQQISALRTEIARLQMELMEYKTGKRMVGEDGMEGINDLVHENSMLQTENNNL
RVRVKAMQETIDAQRARLTQILSDQANQALAKAGEGNEEIGNMIQNYIKEIEELRAKLLE
SEAVNENLRKNLSRASTRSSLYGGPTLLAPGKEARDVIEMAKKDLEKLKKKEKKKKKRSP
QPKSIIVRRLLIVVKEELPDNDQERGNEEAEVEGSDHEEGEDADGEEEDFEMAGEETSEE
SDSEELDEKENVQADLANITCEIAIKQKLIDELENSQRRLHTLKQQYEQKLMMLQNKIRD
TQLERDKVLHNMGSVESGTEEKAKRIKAEYERKLSSMNKELQKLQSAQKEHARLLKNQSQ
YEKQLKKLQQDVTEMKKTKVALMRQMKEQQERNRATECRRNREIASLKKDQRRAEHQLRQ
LEAQKRQQELILRRKNEEVTALRRQVRPVSGKVSRKVSLPEPPQEPSHRAVPGRLQSSSA
SSSNGASVSVHVTQLSETPERMRSSLGVPQCGCRSARAKWQSLERRINDIIMQRMTISNM
ETDMNRLLKQREELTRRRERVSRKREKSAVDGADADRSLASLNEELESLSANIDYINDSI
ADCQANIMQMEEAKEEGDTVDAAAVISSCNLSEARFLLDHFMTMAINKGLQAAQKDSQLK
VMEGRLKQTEINSATQNQLLFHMLKEKAEINPELDALLGSALQENGDDSSSDESTPSPAT
EGRFNEDFNMRTQPLKNVFKFKTEFTLSYLIHSGDLSCESPTGDFSAPLLPLAERLEGPA
DMQGQAVGQTADREQTVSPSVLSARPAAMKQVERSPLSRRKMHEKGGVASQIPGPVHAAP
VSTAETKTKGSDYKSLFSHVSVRPQLDNYNRAIHEPLVCRGVINPVTSPKNSRGGKLQCV
YVAEGHTKPVLCVDATDDLLFTGSKDRTCKVWNLVTGQEIMSLADHPSSVVSVRYTSSLV
FTVSTAYIKVWDIRDSAKCIRTLTSSGQVGSGDTCSSARSLSIPPGESQINQITLNHTGS
FLYAAAGNAVRMWDLRKFVSTGKLTGHLGPVMCLTVEKLGNGQDLVLTGSKDHHIKMFEV
TEGAQGSITSCHTFDPVHQDSVESLTVHGDFFYSSSRDYYIKKWDLASKKLLQSVNAKAD
WVSALGVVPGSPVLLSGCRGGLLRLWHTDSLAPLGEVQGHDSPINGLATNSSQLFTASDD
RTVKIWEAK
Download sequence
Identical sequences I3JU22
ENSONIP00000012367 ENSONIP00000012367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]