SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012372 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012372
Domain Number 1 Region: 478-681
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.8e-32
Family ABC transporter ATPase domain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 100-356
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0000131
Family ABC transporter transmembrane region 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012372   Gene: ENSONIG00000009846   Transcript: ENSONIT00000012381
Sequence length 737
Comment pep:known_by_projection scaffold:Orenil1.0:GL831168.1:1684352:1704162:-1 gene:ENSONIG00000009846 transcript:ENSONIT00000012381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNILDAASKVRWDRTAAAKRAVFLAAAAYGVRTLYPIICKQLCKNKDPGSNHRASKAEN
GSTCSGKTQTDPVIDRKASPGVNADFFKQMLELGKILFPKLVSRELALLSLHSVALISRT
FLSIYVASLDGKIVKTIVEKKPKRFIIQLIKWLLIAIPATFVNSAIRYLECKLALAFRTR
LVNHAYRTYFTDQTYYKVSNMDGRLANPDQSLTEDVMMFSQSVAHLYSNLTKPILDVMLT
SYTLIQTARSRGANASGPTLLAGLVVFATAKVLRACSPKFGKLVAEEAHRKGYLRYVHSR
IIANAEEIAFYRGHKVEMCQLQKCYRALADQMNLILSKRLWYIMIEQFLMKYVWSGAGLV
MVAVPIITATGFADSETADGQTQVMVSERTEAFTTARNLLASGADAIERIMSSYKEVTEL
AGYTARVHNMFVVFEDVQKGIYKRSSVSATTTTEKKSKPEMHIDGPLEIKGEVIDVDKGI
VCENVPIITPNGDVVVSCLNFKVEESMHLLITGPNGCGKSSLFRILGGLWPVYGGRLHKP
SPQHMFYIPQRPYMSVGSLRDQVIYPDSVEDMAARGMSDKDLEAILAIVNLNHIVNREGG
WDAELDWKDVLSGGEKQRMGMARMFYHRPKYALLDECTSAVSIDVEGKIFQAAKDAGISL
LSITHRPSLWKYHTHLLQFDGEGGWRFEQLDTATRLSLTEEKQRLEAQLAGIPEMQNRLN
ELCKILGDDSVLKTAEE
Download sequence
Identical sequences I3JU27
XP_005451828.1.78416 ENSONIP00000012372 ENSONIP00000012372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]