SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012401 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012401
Domain Number 1 Region: 681-864
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-48
Family SPRY domain 0.00081
Further Details:      
 
Domain Number 2 Region: 473-707
Classification Level Classification E-value
Superfamily RNI-like 3.73e-38
Family 28-residue LRR 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000012401
Domain Number - Region: 84-222
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0126
Family G proteins 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012401   Gene: ENSONIG00000009869   Transcript: ENSONIT00000012410
Sequence length 865
Comment pep:novel scaffold:Orenil1.0:GL831635.1:21408:61010:1 gene:ENSONIG00000009869 transcript:ENSONIT00000012410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQEVLDEHKISLRRRCERVSEGSDGTGSRTLLNTIYTELYITEGQSEEVHTQHEVRQLET
ASKMDAFHDTPIRCQDIFKASPDQQRPIRVVLTNGVAGVGKTFSVQKFTLDWAEGLENQH
VSVVVLLSFRELNLIRDEQYSLLELLHVFHPTLQKVTAEKLDVSQLLFIFDGLDESRLSX
RPAAANQIPPTCVDRLTEVRGFTDAQKEEYFRRRFSDEELSSRIISHMKTSRSLHIMCSI
PVFCWITATVLEHMLTTEQRGELPKTLTDMYSHFLLVQTKRKKNKYHEGHETSPQELTEA
DREVLLKLGRLAFKHLEKGNIMFYQEDLEQCGLDVTEASVYSGVCTEIFKRECVIFQKPV
YCFVHLSIQEFLAAVYMFHCHTNMTAKELEDFLRIDYNESSLNVFLKRVMKKSLQSNNGH
LDLFVRFLHGLSLESNERLLGGLLGQTENSPEIIQRAINNLKKMNIDEISPDRSINIFHC
LMEMNDFSLFQEIQKFLKSENRSEKELSEIQCSALAFMLQMSVEALDELDLQKYNTSERG
RQRLIPAVRNCRKARLTGCGLSETHCEVVASALKSNSSHLTELDMSNNELQDSAVKLLFD
GLQSPNCQLETLSLLGCLITEEGCTSLASALSANPSHLRELDLGYNHLGDSGMERLSAGL
KDPGWRLDTLRVEPAGVQWLRPGLRKYSCQLTIDTNTVHTNLQLSDNNRKVTHVKEVQSY
PDHPDRFDVRPQLLCRNGLTGRCYWEVKWRGDIHVSVSYRRIRRKGYSNDCFLGWNDHSW
SLWCYDDGTHSVRHNNRQTSISSSSSSSSSVSNRVAVYVDCPAGTLSFYRVSSDTLIHLH
TFNTTFTETLHPGFWFNSGASVSLC
Download sequence
Identical sequences I3JU56
ENSONIP00000012401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]