SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012412 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012412
Domain Number 1 Region: 36-63,182-376
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.51e-62
Family G proteins 0.0000000163
Further Details:      
 
Domain Number 2 Region: 67-188
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 6.67e-35
Family Transducin (alpha subunit), insertion domain 0.00000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012412   Gene: ENSONIG00000009877   Transcript: ENSONIT00000012421
Sequence length 378
Comment pep:known_by_projection scaffold:Orenil1.0:GL831554.1:29219:37783:-1 gene:ENSONIG00000009877 transcript:ENSONIT00000012421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCLGGKTDEERLDEKAKREANKKIEKQLQRERQTYKATHRLLLLGAGESGKSTIVKQMR
ILHVDGFNAEEKQQKVQDIRKNVKDAIVTIVSAMTILAPPIPLGNPGNQFRADYIKSICC
SSEFLLNQEFFEHAQKLWEDDGVKACFERANEYQLIDCAQYFLDRLDSVRRPDYSPTDQD
LLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVAASSSYNMV
IREDNSTNRLRESLDLFRSIWTNRFLKTISVILFLNKQDVLAEKILAGKSKLEDYFPEYN
NYQLPADAVPDNDEDPKVMRAKFFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIRRVF
NDCRDIIQRMHLRQYELL
Download sequence
Identical sequences I3JU67
ENSONIP00000012412 ENSONIP00000012412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]