SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012425 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012425
Domain Number 1 Region: 490-689
Classification Level Classification E-value
Superfamily RNI-like 1.47e-29
Family 28-residue LRR 0.00035
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000012425
Domain Number - Region: 81-233
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00104
Family Extended AAA-ATPase domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012425   Gene: ENSONIG00000009887   Transcript: ENSONIT00000012434
Sequence length 689
Comment pep:novel scaffold:Orenil1.0:GL831554.1:199002:218903:-1 gene:ENSONIG00000009887 transcript:ENSONIT00000012434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HKFKSNLKKRLQCVFEGITKAGNKTILNQIYTELYIIEGGTAEVSNKHEVTQIETASRKL
DRPEATIRQEAIFRASPGRDEPIRTVLTMGVAGIGKTVLAHKFTLDWAEGKTNQDIQFMF
PFTFRELNLLKEEKFSLXFQVVFIFDGLDECRLPLDFHKTKILTDVTESTSVNVLLTNLI
RGKLLPSAHLWITTRPAAANQIPSDCVCMVTEIRGFTDPQKEEYFRKRFRDREQAGRIIA
HIETSQSLHTMCHIPVFCWITATVLENFLKTSEGRDLPKTLTDMYSHFLVLQAKGKKGKS
NGGADRDSWWSPEIRKMIEYLGKLAFDQLQKGNLIFYESDLTECGIDISDASVYSGMFSH
IFKEERGLYQDRVFFFTHLSVQEFLAALYVHLTFINSGVNLLKEKTYQLSKVFRNKHTVK
QFYKSAVKKALQSPNGHLDLFLRFLLGLSMLNNESPSQGLLTQTGSILQNNQETVQYIKK
KINENLSAEKCINLFHCLNELNDRSLVEEIQQSLRSGILSTDKLSPAQWSALVFILLSSE
KDLNEFDLKKYSDSNSEEALLRLLPVAKASKKVLLRGCNLSERSCEALATILSSPSNNLK
ELDLSETSLPDSGMKLLSSGLMSTHCTLDSLSLWNCCLSEISCALLGSALKTNPAYLREL
DLSKNNLQDPGVNQLCGFLESPHCRLETL
Download sequence
Identical sequences I3JU80
ENSONIP00000012425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]