SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012746 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012746
Domain Number 1 Region: 174-268
Classification Level Classification E-value
Superfamily AMPKBI-like 5.1e-35
Family AMPKBI-like 0.00000681
Further Details:      
 
Domain Number 2 Region: 75-159
Classification Level Classification E-value
Superfamily E set domains 1.34e-28
Family AMPK-beta glycogen binding domain-like 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012746   Gene: ENSONIG00000010137   Transcript: ENSONIT00000012756
Sequence length 268
Comment pep:known_by_projection scaffold:Orenil1.0:GL831134.1:8828840:8831076:1 gene:ENSONIG00000010137 transcript:ENSONIT00000012756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTSDRVAGDRHGAKAHRTDSGSGSKDQEPSSKMVDSTDDPNTFNTHGPESKASGEKEF
TPDLDDLVKTGPQARPTVIRWAGGGKEVYIAGSFNNWNTKIPLNKSHNDFVAILDLPEGE
HQYKFFVDGQWVHDPSEPVVTSQMGTINNLIHVKKSDFEVFDALQVDSLECSDTSDLSSS
PPGPYGQEQYVFRPEEHFKAPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYAL
SIKDGVMVLSATHRYKKKYVTSLLYKPI
Download sequence
Identical sequences I3JV51
ENSONIP00000012746 ENSONIP00000012746 XP_003438230.1.78416 XP_005476249.1.78416 XP_005476250.1.78416 XP_005476251.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]