SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012822 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012822
Domain Number 1 Region: 32-57,175-352
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.67e-62
Family G proteins 0.000000147
Further Details:      
 
Domain Number 2 Region: 61-182
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 7.98e-41
Family Transducin (alpha subunit), insertion domain 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012822   Gene: ENSONIG00000010197   Transcript: ENSONIT00000012832
Sequence length 354
Comment pep:known_by_projection scaffold:Orenil1.0:GL831185.1:153431:234905:-1 gene:ENSONIG00000010197 transcript:ENSONIT00000012832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCTLSAEERAALDRSKAIEKNLKEDGLTAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGDDVKQYKPVVYSNTIQSLAAIVRAMDTLGLEYGDKERKADAKMVCDVVSRMEDTEPY
SAELLSAMMRLWSDSGIQECFSRAREYQLNDSAQYYLDSLDRIGAADYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFAEKIKKSPLSICFPEYTGPNTYEDA
AAYIQAQFESKNRSPNKEIYCHMTCATDTGNIQVVFDAVTDIIIANNLRGCGLY
Download sequence
Identical sequences I3JVC7
ENSONIP00000012822 XP_003447083.1.78416 XP_004569217.1.88231 XP_005754121.1.53837 XP_005945110.2.24487 ENSONIP00000012822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]