SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012828 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012828
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.45e-23
Family G proteins 0.00000838
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012828   Gene: ENSONIG00000010203   Transcript: ENSONIT00000012838
Sequence length 111
Comment pep:known_by_projection scaffold:Orenil1.0:GL831185.1:161014:168864:-1 gene:ENSONIG00000010203 transcript:ENSONIT00000012838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHESLKLFDSICNNKWFEETSIILFLNKKDLFETKISKSPLSICFPEYTGVNTYTEGLGY
IKSQYESKNKSPKKEVYSHVTCATDTNNIQFVFDAVTDVIIANNLKGCGLY
Download sequence
Identical sequences I3JVD3
ENSONIP00000012828 ENSONIP00000012828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]