SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013079 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013079
Domain Number 1 Region: 41-106,138-232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.89e-24
Family G proteins 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013079   Gene: ENSONIG00000010408   Transcript: ENSONIT00000013089
Sequence length 756
Comment pep:known_by_projection scaffold:Orenil1.0:GL831481.1:58092:83253:1 gene:ENSONIG00000010408 transcript:ENSONIT00000013089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSALKKLVGSEPGQLKEKNIPAGLQSMNQSLQRRFAKGVQYNMKIVIRGDRNTGKSTLW
HRLQGKKFVEEYIPTQEIQATSIHWNYKTTDDVVKVEVWDVVDKGQKYPLPEGVGKGKRR
GDNLKLENEPQESDEVALDAEFLDVYKNCNGVIMMFDITKQWTFNYILRELPKVPTHVPV
CVLGNYRDMGEHRVILPDDIRDLIAGLNRPMGSSYIHYAESSMKNGFGLKYLHKFFNIPF
LQLQRETLLRQLETNQLDMDATLEELCVQQETEDQNYEIFLENLESRSKGYGSPGPANGQ
SPSSGSQSPIVPPSGASTGSSSPSTPQPPIPSQPLPQSPSVPTTSPPPPTAAAGGAASPT
AEVKSLAQSPEHLQSPAAGASGPQKRSFISRWFGSSPAIETSASGPEEPPAPVCPAKVQS
VDDFVPDERLDKSFLEDSLPSKTKVPQPAAAPTVDSDSDGEDRGNPMVSSFQDELDPDDT
EPSLSNSKTFPPIKDITLSSDEEEGIPTALVISQDQDLESKPELKAPMITKPKVASKAPD
PQGQTTPPISLTLTPAAEQPARHQGKKKGNTPKAEDSDTDPEAPVAQQMLSFVMDDPDFD
SEASDTPKIAKDTFPVRDELLSDLSDDDMQLAKVPEPLKPTVITFKPKDDTDLFGLGIQE
ELPATKESSEDQEEKESKHSSKERKKKKKKSKEEDEKSKKKHKHKKKEKDEAAAPDEKEK
KKKKSRTKKTEVDELEDFLGGGAASIKRDDGDYEEL
Download sequence
Identical sequences I3JW34
ENSONIP00000013079 ENSONIP00000013079 XP_019221090.1.78416 XP_019221091.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]