SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013110 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013110
Domain Number 1 Region: 42-259
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-63
Family SPRY domain 0.0000000162
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000013110
Domain Number - Region: 248-285
Classification Level Classification E-value
Superfamily SOCS box-like 0.00016
Family SOCS box-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013110   Gene: ENSONIG00000010430   Transcript: ENSONIT00000013120
Sequence length 286
Comment pep:known_by_projection scaffold:Orenil1.0:GL831134.1:10450342:10546724:-1 gene:ENSONIG00000010430 transcript:ENSONIT00000013120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKISGSIKSVDGRGESGGSPSYRPLTHRRQHPELRGPDFFKPPRLDLLLDMPCAGLET
QFRHAWNTDDRSLNIFIKEDDKLTFHRHPVAQSTDCIRGRVGYTRGLHVWKINWPVRQRG
THAVVGVATSEAPLHSVGYTALVGSDCESWGWDLGRNRLYHDSKNRAHSSLPSYPCFLEP
EESFTLPDSLLVILDMDEGTLSFMVDGQYLGVAFRGLKGKKLYPIVSAVWGHCEISMKYI
NGLDPEPLPLMDLCRRAARVALGRDRLQEIERLPLPQSLKNYLQYQ
Download sequence
Identical sequences I3JW65
ENSONIP00000013110 XP_003438257.1.78416 ENSONIP00000013110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]