SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013142 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013142
Domain Number 1 Region: 18-195
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.61e-60
Family G proteins 0.000000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013142   Gene: ENSONIG00000010456   Transcript: ENSONIT00000013152
Sequence length 220
Comment pep:known_by_projection scaffold:Orenil1.0:GL831134.1:10659786:10669975:-1 gene:ENSONIG00000010456 transcript:ENSONIT00000013152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMASANATYGQKESTDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK
VKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQI
KTYSWDNAQVLLVGNKCDMEDERVVAAERGRQLSEQLGFEFFEASAKDNINVKQTFERLV
DIICERMAESLDNNDPTITGAKQGPQLSEQPQRSHQDCAC
Download sequence
Identical sequences I3JW97
ENSONIP00000013142 XP_003437808.2.78416 XP_004542466.1.88231 XP_006786795.1.46954 ENSONIP00000013142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]