SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013143 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013143
Domain Number 1 Region: 75-125,231-411
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.96e-35
Family PAPS sulfotransferase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013143   Gene: ENSONIG00000010457   Transcript: ENSONIT00000013153
Sequence length 436
Comment pep:known_by_projection scaffold:Orenil1.0:GL831185.1:3433784:3440739:1 gene:ENSONIG00000010457 transcript:ENSONIT00000013153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHCQWERCRVRGGGRMECSWKTVLLLVCASLGVQYTAIRTLRDSLSGPCQGAYRCQSRHL
RDSRWRTSCDDSWLPMDSPRKHILLFATTRSGSSFTGQLLNQHPGVFYVFEPLYHVQQAF
TNSSSRLRRTLDRRALLGAYRDLLLNLYTCELHFMENYIRPEPQEHITSSFFRRSSSHAL
CSPPVCSDGVVAAASDPPDETWCPKKCGALNLTLASMSCLSRGHVAVKTVRVPEVGDLRT
LTEDPRLDLKIVHLVRDPRAILASRMMAFSDQFRAWKIWNATGRQPRYVDLSQITSTCKD
MVASVETGLQRPAWLRGRYLLVRYEDLAFNPKDKASEIYKFAGLEMEDRVRTWIAKNTNS
NASSPSEWNYRYSTTRDSRVTAESWRLRLGFDIVRTVQNLCNDTLALLGYKQVRSVAELR
NLSQSLVEHRTFQPVT
Download sequence
Identical sequences I3JW98
XP_003447184.2.78416 ENSONIP00000013143 ENSONIP00000013143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]